CAZyme Information: MGYG000000414_02069

Basic Information

• Species: Alistipes sp900546065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900546065
• CAZyme ID: MGYG000000414_02069
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
905	MGYG000000414_18|CGC1	102032.16	5.1732

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000414	2648727	MAG	Sweden	Europe

• Gene Location: Start: 28991; End: 31708 Strand: +

Full Sequence      

MKSGLGDGAVRFCRRAAAAAAIVAAVVMSSCGGDDERVKIVGLRCEYAEEPLTIDGDSVR
FTWRYESDEPVASFRQHKVEVRIATDEESLADEESCEATSGRVRGGQMIVLPTDSLDAES
RYCWQVRGYNALGVETMVSPVAWFSTAKLHGKAWSAKWITDSYDRNYEPAPMFRKRFRLS
GNVERASLYISAAGYYDAAINGSRVSDDWLDPGYTHYDKRNLYQVHDVTALVHDGDNVIT
ATLGNGFYNEYTGMAVWQFESARWRNRPRMICELHVLYSDGRRQKVVSNSTWRTTTGEVR
GNVIYAGDIIDARCAVEGWNDPAMDDSSYPAAVVCEAPSPLLVAQQMPPIRESETCEPVS
VRRISDREYVFSFARNMTGVCTLRVRGEKGTRIEMEHGELLRDDGTVEMHNIDFHSHPVG
DYSLQRDIFYLRGDGRMESFTPRFHYNGFQYVTVTADRPIELDRSSLTAHFLHTDVQSVG
DFRSSNELLNSLWQAVRRSYLCNLQGIPTDCPHREKNGWTADAHVSIDIGLANYDGITVY
EKWIDDMIDNQREDGSISGIIPSAGWGYDDWIGPVWDAAMFIIPDALYNYYGDVRAIEKI
YPVAERYLEYLAGRENEDGTVTYGLGDWCFYKTQTPSDFTTTCFYYYDQKLMARFAALTG
RDGSKYEAKAEALRELINTKYLDSETGIYSIGRVTAQAVPLALGIVPAGMEAKVAARLND
VVVEDGYTCDFGLLGSRYALRMLVKYGYVETAYKLATQTRRPSWGNWIVEGFTTPLETWA
LRENFSDSSANHVFFGDIAAWMQSDIAGINYDEQKPGFENIIIRPHFPAEMEWAEASYHS
VRGVVRSAWHRSRNHIILEVTIPLNTTATIYTDGVYKIKGNGSTYRFVVNERAAAKSARN
DGGRR

Enzyme Prediction     

No EC number prediction in MGYG000000414_02069.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	362	871	1.1e-144	0.9940476190476191
CBM67	156	337	9.5e-38	0.9602272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	5.65e-107	479	802	3	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.98e-58	183	354	3	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	4.03e-20	362	473	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	6.63e-16	808	871	1	62	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM10804.1	0.0	38	874	27	864
QUT32044.1	0.0	38	874	27	864
CBK67657.1	0.0	38	874	27	864
QRM99258.1	0.0	38	874	27	864
QNL40265.1	0.0	38	874	27	864

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	3.08e-142	43	891	35	909	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	2.87e-98	170	871	302	993	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	7.72e-72	46	874	10	848	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	1.27e-97	170	871	302	993	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	5.26e-92	51	870	43	904	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
P9WF03	2.36e-77	51	878	43	884	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1
T2KNB2	2.57e-77	116	896	111	910	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000076	0.003890	0.996043	0.000009	0.000006	0.000002

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000414_02069.