CAZyme Information: MGYG000000414_00125

Basic Information

• Species: Alistipes sp900546065
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900546065
• CAZyme ID: MGYG000000414_00125
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
836	MGYG000000414_1|CGC2	92485.21	4.8276

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000414	2648727	MAG	Sweden	Europe

• Gene Location: Start: 155649; End: 158159 Strand: -

Full Sequence      

MITTKRVKGLLAVGICIFCCTALSRCGGTASDTEGGEALQPVPFQKVEIEDNFWLPRLKT
QKHTLVPFALGKTEPAVENLRRVGAYLRGEKTEGLLPLARYVASDLFKVMEGAAYLLTVE
PDEELERRMDEIIDIIVAAQASDGYLYESHIMGSAMVNSADGGTGDKPYSWVVHSHELYN
MGHMYEAAVAYYQATGKRKWLDAAEKSARHINHVFFEGDPAYNDGKPVNQAPGHQEIELA
LVKLFRVTGDSLYLNMAKRFLDIRGVTYRPDGEGVMAPDYAQQHMPVREQRTAVGHAVRA
TYMYSAMADVGALTGDTTLRPALESIWHDIVDRKMHITGGLGAVPGIEGFGPDYVLPNKN
TYDETCAGVGNVFFNYRLFLMERDARYVDVAEVALYNNVLAGVNLAGDRFFYVNPLEADG
RKAFNQGHRGRSPWFGTACCPSNLARLIPQVPGMVYSQTDDEIFCALYAGCSTTLNMACG
DVTLTQRTEYPFDGDVEIEVTPSVDGAEFTLWLRVPTWCTGEGFVPGELYRYDDGVKCRA
EASVNGHRIRARAVRGFVPVRRKWHAGDKVLLRLPMPVRSSAADERVEDDRDRRCITRGP
LVYCAETADNSYPVSEYFVGGGSVETDSVYRAADGVLKGIVEMGVEAEAVAGDGTSAAEL
TLIPYYAWDNRGDDAMNVWFARSEATARESAFHFARNISGVKASFTYSGDDEYAVADSAV
PDNSSDTKIPRWTSWPECGKEQWVEVTLAKPMAVESVAVYWYDDGGGVQLPVSWSMEYRS
QGEWHTFRPYTTDCFGVERDQFNMVHPDEQITADALRLKIVPKASAAAGILELEVN

Enzyme Prediction     

No EC number prediction in MGYG000000414_00125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	47	604	1.7e-175	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	5.01e-148	47	604	2	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	9.60e-140	35	684	5	589	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd00249	AGE	1.28e-06	109	263	120	270	AGE domain; N-acyl-D-glucosamine 2-epimerase domain; Responsible for intermediate epimerization during biosynthesis of N-acetylneuraminic acid. Catalytic mechanism is believed to be via nucleotide elimination and readdition and is ATP modulated. AGE is structurally and mechanistically distinct from the other four types of epimerases. The AGE domain monomer is composed of an alpha(6)/alpha(6)-barrel, the structure of which is also found in glucoamylase and cellulase. The active form is a homodimer. The alignment also contains subtype III mannose 6-phosphate isomerases.
COG1331	YyaL	1.84e-04	187	316	418	553	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].
cd04791	LanC_SerThrkinase	0.001	187	341	94	244	Lanthionine synthetase C-like domain associated with serine/threonine kinases. Some members of this subgroup lack the zinc binding site and the active site residues, and therefore are most likely inactive. The function of this domain is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SCD19473.1	0.0	34	836	22	821
QJE94520.1	1.87e-308	37	836	25	819
BBO34810.1	2.30e-303	20	836	7	825
AIA99612.1	1.79e-300	30	834	23	825
QDV74096.1	6.60e-291	36	836	36	836

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.04e-158	36	679	4	622	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
4QJY_A	1.51e-124	47	679	16	644	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	4.30e-119	47	679	16	644	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
3WKW_A	6.65e-94	104	683	76	659	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	7.08e-94	104	682	76	658	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	3.88e-93	104	682	76	658	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000018	0.003749	0.996261	0.000003	0.000007	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000414_00125.