CAZyme Information: MGYG000000408_00105

Basic Information

• Lineage: Bacteria; Cyanobacteria; Vampirovibrionia; Gastranaerophilales; Gastranaerophilaceae
• CAZyme ID: MGYG000000408_00105
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000408_1|CGC4	43183.86	9.7596

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000408	1810289	MAG	Sweden	Europe

• Gene Location: Start: 115323; End: 116444 Strand: -

Full Sequence      

MKKLFIITGEHSGDLHASFVVNHLKELNPNIEIEAIGGENLKRTGIKLFNDHSKMQSMGF
NLKMLFDHFIIGKKLLNYLKTEYKPDLVLLIDYGGFNLNIAKFLKKDGFKIYYFIPPQIW
ASRKWRIKSVKKYIDKVLTIFPFENKLYEEAGINVEYVGHPLVKELALNKETKKDLLFQK
YDLDKNKKLVSIFPGSRELELKYLLKTFLKSKEKIEKKISDIQFVIAQANNISDELLNKY
LKDYPIKVIKQENYALLKHSDALILASGTVALEAALYGTPMLISYKGPWLLYLIYLLVRC
INKVSLPNIILNKIVIKELIQWKSNADDISEEIVKILQDNEYRNNMTKNLEAVRSLISDK
DATYQVALSILEL

Enzyme Prediction     

No EC number prediction in MGYG000000408_00105.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	355	3.8e-104	0.9830508474576272

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	4.20e-105	1	373	1	374	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	6.80e-90	1	373	1	378	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.00e-70	4	345	1	347	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	4.51e-61	6	373	10	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	1.23e-38	1	327	1	307	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOR39331.1	1.56e-147	1	372	1	370
QKJ96197.1	6.64e-77	3	373	7	377
QMU61387.1	1.08e-76	4	367	13	377
AJQ25963.1	1.03e-73	1	371	1	372
ADR19367.1	3.34e-73	1	367	1	358

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	8.46e-35	6	373	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.17e-34	6	373	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B3E4H8	1.73e-65	2	367	7	373	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q3A550	2.41e-64	2	373	8	381	Lipid-A-disaccharide synthase OS=Syntrophotalea carbinolica (strain DSM 2380 / NBRC 103641 / GraBd1) OX=338963 GN=lpxB PE=3 SV=1
A9KC41	6.18e-64	2	367	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain Dugway 5J108-111) OX=434922 GN=lpxB PE=3 SV=1
B6J161	6.18e-64	2	367	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain CbuG_Q212) OX=434923 GN=lpxB PE=3 SV=1
Q83DS5	6.18e-64	2	367	4	367	Lipid-A-disaccharide synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) OX=227377 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000408_00105.