CAZyme Information: MGYG000000400_00011

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173
• CAZyme ID: MGYG000000400_00011
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
591		65238.02	5.2832

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000400	2908659	MAG	Sweden	Europe

• Gene Location: Start: 11051; End: 12826 Strand: +

Full Sequence      

MTRINLKKFSLLPVMLLWAVCQETSAKETKIVEAVVQPQAIVWISDTTGVYVNSPEKLFS
DFPGQVSVNNSASCMVLRSADGHKPSLLLDFGKEIYGSVKIYTGMAASNKPKHVRVCMGE
SVTEAMSDTDILSNPQNPTNEHSMRDYVLSLPWLGSAESSKTGFRFVRVDFVDEDAELPL
LHIEARSFLRDMEDVGSFACSNSRLTDIWNTGAYTVKLNMQDYVWDGIKRDRLVWLGDMH
PEIMTIGNVWGDVDVAKRSLDFARNDTPLPGWINSMCAYSLWWLIIQNDYNDYTGDMTYL
AEQLPYTRGLLKQIAGCVSESGEEHLDGKRFLDWPTSENQEAIHSGLQSLTIIAVASAAE
IGRKLDDKELVSDANRLLERLRKFHIDSGGNKQAAALAILSGQSTDIEKDVAVILRGGAD
GFSTFYGYYMIEALAKAGHSDDAQKLISDYWGAMLDLGGTTFWEDLDYNDVKNAAPIDRM
VPAGKHDIHADGGDYCYKGLRLSLCHGWASGPTSWMTRHLLGVRPLEPGCSVIEVAPNLG
KLEWAKGTFPTPKGAVEISVKKDASGNDVATVKAPEGIKVINRTSGGRRTK

Enzyme Prediction     

No EC number prediction in MGYG000000400_00011.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	86	579	3.8e-90	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.35e-14	193	520	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	0.006	522	562	1	42	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI61840.1	5.32e-244	21	581	14	573
SCM59046.1	1.06e-212	31	581	38	587
CEA16344.1	2.80e-207	30	578	42	590
SCD21002.1	4.84e-201	28	581	35	588
BBD46130.1	9.72e-201	23	581	30	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	2.97e-38	63	577	171	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	3.08e-27	161	580	502	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.97e-18	86	518	94	539	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WF03	7.70e-11	84	570	365	865	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000360	0.249407	0.749867	0.000150	0.000118	0.000099

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000400_00011.