CAZyme Information: MGYG000000398_01351

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000398_01351
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000000398_8|CGC1	35951.3	4.3632

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000398	2936252	MAG	Sweden	Europe

• Gene Location: Start: 15233; End: 16171 Strand: +

Full Sequence      

MQKPVNQNASPEAAALLNYLEQTAGRGIITGQHTQTNPMEEITYIREITGKQPKLRGFEL
LAYSPNINEADAGEACLTEVYENRDTLKTAMKWAKESDGIVTFSFHWFSPLGGRDKSFYA
EHTDFDPAKVLVEGTPEREAFYHDMKVIAGYLEEFKEAGIPILWRPFHESDGTWFWWGSK
GPEVARDLYLLMYDYYVNECHLDNLLWVWNCRLPEGYPGDAFVDIVSVDIYLPEYAPTDY
AKEYEELIRATSTNKVAALAEVGYMPDVDMLAESHTPWAYYMTWSKEFCIGEQYNSKENL
RRMYDSTYAVTE

Enzyme Prediction     

No EC number prediction in MGYG000000398_01351.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	5	311	2.3e-94	0.9867986798679867

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.90e-47	5	312	1	309	Glycosyl hydrolase family 26.
COG4124	ManB2	2.18e-16	145	264	164	297	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK82137.1	2.72e-165	1	311	1	311
QNM01251.1	1.05e-160	9	311	13	333
AEB13973.1	4.43e-147	1	311	1	309
AZK45707.1	3.83e-134	4	311	6	313
AOZ93051.1	1.99e-132	4	311	9	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPF_A	2.41e-58	4	311	6	306	Structureof Inactive E165Q mutant of fungal non-CBM carrying GH26 endo-b-mannanase from Yunnania penicillata in complex with alpha-62-61-di-galactosyl-mannotriose [Yunnania penicillata]
3ZM8_A	7.22e-56	6	311	147	443	ChainA, Gh26 Endo-beta-1,4-mannanase [Podospora anserina S mat+]
3WDQ_A	2.37e-48	4	311	34	348	Crystalstructure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus [Symbiotic protist of Reticulitermes speratus],3WDR_A Crystal structure of beta-mannanase from a symbiotic protist of the termite Reticulitermes speratus complexed with gluco-manno-oligosaccharide [Symbiotic protist of Reticulitermes speratus]
6Q75_A	4.50e-41	4	311	23	323	Thestructure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75],6Q75_B The structure of GH26A from Muricauda sp. MAR_2010_75 [Muricauda sp. MAR_2010_75]
6HF2_A	1.05e-38	7	284	48	314	Thestructure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus [Bacteroides ovatus ATCC 8483],6HF4_A The structure of BoMan26B, a GH26 beta-mannanase from Bacteroides ovatus, complexed with G1M4 [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G2Q4H7	9.71e-59	6	311	176	472	Mannan endo-1,4-beta-mannosidase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Man26A PE=1 SV=1
Q5AWB7	1.43e-50	3	311	27	346	Probable mannan endo-1,4-beta-mannosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=manE PE=3 SV=1
P49425	1.57e-50	6	311	148	453	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3
A2R6F5	1.70e-46	5	310	29	328	Mannan endo-1,4-beta-mannosidase man26A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=man26A PE=1 SV=1
P55298	3.64e-43	5	304	157	448	Mannan endo-1,4-beta-mannosidase C OS=Piromyces sp. OX=45796 GN=MANC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000398_01351.