CAZyme Information: MGYG000000398_01228

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000398_01228
• CAZy Family: GH59
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1110	MGYG000000398_7|CGC1	120655.68	5.4396

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000398	2936252	MAG	Sweden	Europe

• Gene Location: Start: 35698; End: 39030 Strand: +

Full Sequence      

MLKRFLKQAGACLLSVSMILTSNVGSAGVSASSRKGDAVETKTGSIVINGDDIKADNVNG
LTYKGFGLLSANSTSDLLMDYKSQNPEKYAELMQYLFGGQYPIFTHVKLEMGNDSNTSTG
PESATMRTRDEKANVLRNPGWQLAADAKKINPNLKVSILSWCTPTWVKKDEDKYYWYKQS
ILAAYEQYGFMVDYINPNTNESWGGKGDIATTKKFAQWIAEESADTISDEKELALFHKIK
LIVSDEANVVSDSVAENLKSDQEFMDAVDVVGYHYKTADDSNGGMKWFAEEMDKEVWNSE
EQATFSNSAFRPAGNDKAPTVAGTGIGGSGSALEMGNTVIKSFVDSRRSHVIYQPAIGSF
YEGGEYSFKELVSARDPWSGWMHYDAGLLVLAHISKFAVTGWENESNTAGIWRGVPSASK
ASAVQTTSSNAVDGRVGGENYMTLAAPTKDNFSTVIVNDSEYPMTYTLKTENMNLKADQK
LELWETRAADDGAFNENYMKRIQEVSADAEGVYSFEVKPNSAVTVTTLEVSDSEEHTKAL
PVEGERTVLDTDATGDVQDTANEYLYADNFEYTGKTVPVLDGKGGFTGETEDYIASRGGD
TGAMARYTHTLNGAFEVYKDENGNHVLRQQRDKQATGVGRAWNKGDPVTLIGDYRWTNYA
ASIDVMFERAADSQYAQVGIRQTGRTYNISNCAGYSLKVNDNGTWALYRAKFGSSSASGE
ELASGSVDASQVTPETWFNLELRGEGNVIKAYVNNSLIAEYEDANPITSGRIAIGSGNTY
TRFDNLEVKKLEGYAPYYNEYIDNMETYDLTPEKNPKLVYDDKWSITCQNHGMYTYQRSA
SYSTGVGATLSYTFKGTGLEILGYNKSDKTTLNVTVDGNIYQTAAPLWKSDNMCTEYQLA
GLEDAQHTVTIEVASGSLAVDAVAVTGSVYGAKADETPSPAPSATAVPSAAPSGAPAQDP
QTQTLTVKKGDTFKVKDITYVVTNAEKKTVVLKKAENKKSKAIVVPASVKTAAGTFRVTG
ISDKAFAGCSSLTKVTIGKNVTSIGKEAFAKDKNLKKIVIKSSGLKKVGKNAIKGISGKA
KISCGKKNVTAYKKLFTGKTGYVKSMKITK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH59	57	789	1.2e-171	0.993660855784469

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02057	Glyco_hydro_59	1.29e-93	63	395	1	292	Glycosyl hydrolase family 59.
sd00036	LRR_3	3.53e-12	1003	1075	65	127	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	8.67e-12	1003	1082	19	88	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	3.65e-11	1018	1075	48	104	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.
sd00036	LRR_3	5.48e-11	1021	1083	5	66	leucine-rich repeats. A leucine-rich repeat (LRR) is a structural protein motif of 20-30 amino acids that is unusually rich in the hydrophobic amino acid leucine. The conserved eleven-residue sequence motif (LxxLxLxxN/CxL) within the LRRs corresponds to the beta-strand and adjacent loop regions, whereas the remaining parts of the repeats are variable. LRRs fold together to form a solenoid protein domain, termed leucine-rich repeat domain. Leucine-rich repeats are usually involved in protein-protein interactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL75594.1	5.87e-298	47	932	35	915
ABG76970.1	5.87e-298	47	932	35	915
AJQ96197.1	1.42e-289	45	925	308	1183
AUX40340.1	2.22e-289	45	925	56	931
QNK59157.1	9.16e-289	46	925	315	1188

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P54804	8.89e-25	45	789	19	666	Galactocerebrosidase OS=Canis lupus familiaris OX=9615 GN=GALC PE=1 SV=1
B5X3C1	8.22e-24	60	668	34	550	Galactocerebrosidase OS=Salmo salar OX=8030 GN=galc PE=2 SV=1
O02791	6.17e-23	60	789	52	682	Galactocerebrosidase OS=Macaca mulatta OX=9544 GN=GALC PE=1 SV=2
Q5SNX7	9.91e-23	60	788	30	657	Galactocerebrosidase OS=Danio rerio OX=7955 GN=galc PE=2 SV=1
P54803	9.93e-22	60	789	52	682	Galactocerebrosidase OS=Homo sapiens OX=9606 GN=GALC PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000395	0.998863	0.000211	0.000195	0.000178	0.000156

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000398_01228.