CAZyme Information: MGYG000000398_01172

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; TF01-11
• CAZyme ID: MGYG000000398_01172
• CAZy Family: GH5
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000000398_6|CGC4	39875.62	10.035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000398	2936252	MAG	Sweden	Europe

• Gene Location: Start: 163418; End: 164512 Strand: -

Full Sequence      

MEKMKNRMGKGLIAVLIAVGVVGIVLTGVSYKAWTEKQAASGTEAAVAADVTGAVSEELT
KTAQAAGAAPVEQHGALHVSGTDLKDSHGAKFRLKGVSTHGIAWFPQYVNKDAFQTLRDN
YGINTIRLAMYTNKSEGYGPDAVKKVQEGVKYATELGMYVIIDWHILNDGNPNQHKSEAK
KFFTKMSKKYGSQKNVIYEICNEPNGNVTWNKQIKPYAKTMVKVIRKHSKNAVIVIGTPT
WSQDVDVVAQSPLKGKNLMYALHFYAGTHKEWNQEKLKTAHKKGLPVIVTEFSICDASGN
GALDKASGNKWLRLLDKYNISYTAWSLCNKNESSALIASSCSKTSGWTSGDLSAAGKWYF
NKTK

Enzyme Prediction     

EC	3.2.1.4	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	88	323	4.6e-91	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	2.42e-74	86	331	2	272	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.02e-15	95	335	68	368	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
COG3867	GanB	3.34e-05	101	165	55	125	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].
pfam07745	Glyco_hydro_53	0.001	111	165	27	79	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK83877.1	1.07e-118	51	358	208	522
QNM00780.1	6.39e-117	70	358	214	507
QWT53734.1	8.20e-115	41	358	190	507
AFA47670.1	6.46e-111	70	358	198	493
QTU84139.1	2.48e-107	73	361	204	496

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XZW_A	4.31e-104	70	358	5	297	Endo-glucanasechimera C10 [uncultured bacterium]
6GJF_A	8.80e-104	67	358	3	295	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
4XZB_A	1.02e-102	70	358	5	298	endo-glucanaseGsCelA P1 [Geobacillus sp. 70PC53]
3PZT_A	6.32e-102	63	356	22	317	Structureof the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZT_B Structure of the endo-1,4-beta-glucanase from Bacillus subtilis 168 with manganese(II) ion [Bacillus subtilis subsp. subtilis str. 168],3PZU_A P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZU_B P212121 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_A C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_B C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_C C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168],3PZV_D C2 crystal form of the endo-1,4-beta-glucanase from Bacillus subtilis 168 [Bacillus subtilis subsp. subtilis str. 168]
1A3H_A	4.09e-88	71	364	3	298	EndoglucanaseCel5a From Bacillus Agaradherans At 1.6a Resolution [Salipaludibacillus agaradhaerens],2A3H_A Cellobiose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 2.0 A Resolution [Salipaludibacillus agaradhaerens],3A3H_A Cellotriose Complex Of The Endoglucanase Cel5a From Bacillus Agaradherans At 1.6 A Resolution [Salipaludibacillus agaradhaerens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P10475	4.83e-99	59	356	23	322	Endoglucanase OS=Bacillus subtilis (strain 168) OX=224308 GN=eglS PE=1 SV=1
P07983	1.53e-97	59	356	23	322	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P23549	1.71e-96	59	356	23	322	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=1
P15704	1.57e-93	66	356	36	328	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1
Q59394	3.53e-91	65	358	29	323	Endoglucanase N OS=Pectobacterium atrosepticum OX=29471 GN=celN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.922524	0.065223	0.004624	0.000372	0.000234	0.007041

TMHMM  Annotations     

start	end
12	31