CAZyme Information: MGYG000000389_00812

Basic Information

• Species: Roseburia sp900550935
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Roseburia; Roseburia sp900550935
• CAZyme ID: MGYG000000389_00812
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
801		90228.98	5.6794

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000389	2762523	MAG	Sweden	Europe

• Gene Location: Start: 55618; End: 58023 Strand: +

Full Sequence      

MKAVSWNDGWTVKRINEAGEGKPVRIPHDAMLGEKKSADAPGGTNTGWYEGFDYLYEKRF
VPGKEYENKKMILEFEGVYHNAEVWIGGEKAAYRPYGYTNFYVDVTELFRIGEENQICVI
ARNADQPNSRWYSGAGIYRPVTLWVGDEVSIPVNGVKIRTISVNPARVEVRVKTNVKAPV
LIEIFDPSKKETVICSRKTVCEGEVAEVFEIPDAKLWNVDTPFLYQCRVTAGTDVVWEHF
GVRRLTWGEEGILLNGERVILQGACVHHDNGLLGAACDPDAVERKVRLMRENGYNALRSA
HNPCSKAFLDACDRQGMLVMDEYIDHWYIHKTEYDYVNYFEEWWKQDLTDMVEKDYNHPC
VILYSTGNEVSETAQERGIKLTGEMTEFLHSLDATRPVTCGVNIFFNLLSSIGFGVYSDE
KAKKEAEKKPGKKKAVGSQFFNNLAGLLGDEFMKRGATLHGCDVKTRDAFARMDIAGYNY
GIYRYTHDLKKYPDRLILGSETFCKDAYRFREMAKKNPRLVGDFVWAGMDYLGEVMVGSW
EYSDYAKNFEGDLGWVSAGSGRVDLTGKPLCEALYTRVALEQEMGPFIGVCPVDHTNDRH
SPSAWKMSNALESWSFRGHEGKRAKVEIYARAHEVELKINGKSVGRKTLKNDCITRFNCT
YENGTVEAVSYDESGTVIGTALLKTAGEETKIHMEAEEKQVSCGHLAFVRLRYVDNEGIT
KPLERGNLHVTVKGGTLEALGNACPYNEKGYLGTETETYYGEALAIVRAGNEAELEIGAE
DGIHQAELKIPVTEKPNAEWR

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	634	1.4e-97	0.6356382978723404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.59e-56	23	418	70	447	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	6.15e-33	53	406	66	452	beta-D-glucuronidase; Provisional
PRK10340	ebgA	1.27e-25	55	398	112	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	1.07e-19	252	400	8	160	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	4.49e-19	104	398	173	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30385.1	0.0	1	799	1	803
QHB24152.1	0.0	1	799	1	803
QEI31653.1	0.0	1	799	1	803
QOL35067.1	0.0	1	790	1	811
QOL32321.1	0.0	1	790	1	814

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6B6L_A	8.76e-121	1	773	5	756	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	3.65e-120	1	773	5	756	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5T98_A	2.54e-92	4	769	28	794	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	6.82e-83	2	769	8	782	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
5T9A_A	6.57e-82	22	792	57	845	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	9.94e-80	26	794	76	850	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.05e-59	24	692	78	714	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	3.82e-27	56	397	60	411	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
P26257	3.14e-25	64	407	66	421	Beta-galactosidase OS=Thermoanaerobacterium thermosulfurigenes OX=33950 GN=lacZ PE=1 SV=1
T2KPJ7	2.10e-24	12	396	67	464	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000389_00812.