CAZyme Information: MGYG000000383_01537

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA737
• CAZyme ID: MGYG000000383_01537
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
870		100009.65	4.7577

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000383	1702468	MAG	Sweden	Europe

• Gene Location: Start: 675; End: 3287 Strand: -

Full Sequence      

METKDFSRAKYISAPQKSIENLYQQKEKNFPNALYIWPMGCTRFHTYRLFSPKKAVEKTE
LAFLCDNLFDLWLNGVSVVKDTKHLQLTDVTKLLKNGENNLHIRGYQSGSDDFYSAAITG
GVRIYYTDGTVDEIATDRQFKLVQLVNFWETEEPAGFETATEGLYAVEMNVMEQHPIASR
RSFYFIRPFSLQKMPISAHLYSTALGCYEPYLNGERVTDSFFMPFCQNYQREYQDFDVLS
MIHKGDNMLGMITGNGSYNCTSWGQLTAKPPEAMAILELKYDDGKTERIYTDESWQCAPS
PLIENDIQYGERYDARLEKADWCSPAADTTDFVPVSARENIDQTMLLAQNYPYIKKIKEY
PLHEYTVLPDGSFLYDVGICIAGRARITFQNLTAGQKVRIRYCERLTADSLPENGAYTTV
YYQQDCDKDGRSSQFMRNIDVYYAKGDKTETYECRFAYTGFRYIWVECLEDATQIAELTA
FELHNDLKECGEIITDDAAINQIFTATKRSWLNNLFNGPTDCPTREKNYWNGDSQIFSHA
ACWLTDNSDFLARWTENGKKMHAGPYAWEDEIYEIPLTLYAFYGDKEILKRRYPEMLQLI
EKRTEFEGMILPQADSHEYCDWLSPTGVTPDKPFFCGCWYYHMLTRVADVAEIVGDTEKC
AALREKAKAAREEFNRRHLVDNGSDYDARNQCGIVLALAFGIAPEENRRALADTLAEYVR
QADYHLTTGFIGTRFIFEVLADYGYEELAYKVITNKTFPSWLDMLASGATAITESWRGEN
DPDKSLSMAHFSLGSVIAWFFEYLGGIHINESAPGLAHIVLKPVMIKEIGSFAVRYQSKY
GEIYTEWHFENDEPIFSYRVPQGVSVTVEK

Enzyme Prediction     

No EC number prediction in MGYG000000383_01537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	368	869	1.9e-115	0.9900793650793651
CBM67	177	331	1.3e-25	0.8522727272727273

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.34e-69	488	804	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.24e-39	193	358	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	1.30e-10	368	484	3	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.14e-06	809	868	2	61	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGQ94338.1	2.51e-144	8	851	98	955
AQS56111.1	7.09e-104	25	868	87	970
QGY42517.1	3.50e-98	153	868	130	864
CEA16347.1	8.44e-97	184	867	175	871
QMW65243.1	1.02e-96	189	861	307	988

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W5M_A	1.42e-79	198	868	319	992	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6I60_A	7.99e-77	185	865	179	891	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	5.10e-73	178	853	127	822	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q82PP4	6.67e-79	198	868	319	992	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KPL4	4.25e-78	184	861	186	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
T2KNB2	2.33e-61	122	869	121	877	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	2.58e-57	184	865	172	873	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000383_01537.