CAZyme Information: MGYG000000380_00890

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; Erysipelotrichales; Erysipelotrichaceae; Merdibacter
• CAZyme ID: MGYG000000380_00890
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000380_129|CGC1	54722.7	5.1933

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000380	1622044	MAG	Sweden	Europe

• Gene Location: Start: 317; End: 1747 Strand: -

Full Sequence      

MRTDFLWGGATAANQVEGGFDADGKGLSCADLLSNGTREIPRQITPHQSEEGLYYPNRIA
SDFYHHYEEDIRLMGEMGFKCYRMSIAWTRIFPTGEEETPNEAGLAFYDRVFDLLHEQGI
EPMVTISHYEMPIHLVNKYNGWASRETIDHFLRYCRVLFERYHTQVRYWLTFNEINCGTL
ALGNYMSLGIVHEGTRYFTKQIDDPQLRYQALHHQMVASALAVQVGHAIDADLQIGCMIA
MMPTYPLTCHPKDLLKCQKQWQEINYYCTDVMVRGSYGAYTKRMWADRGITLSISDQDRQ
ILKDGTVDYIAISYYQTNCVSHEDDHSMIGGNLLAGVANPYLKASEWGWQIDPDGLRYTL
KELYDRYQRPLMIVENGLGAFDQLESDGCVHDPYRIDYLRQHIRCMKEAIADGVDVMGYT
PWSAIDIISASTGEMAKRYGFIYVDSDDHGNGSFRRIRKDSFYWYANVIASNGEEL

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	473	1e-148	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	476	4	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	476	6	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	4	476	9	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	4	475	7	456	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	2	476	7	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM13366.1	1.80e-248	1	476	3	477
BBK23030.1	1.04e-247	5	476	7	477
BBK23062.1	8.48e-247	5	476	7	477
BBK62637.1	9.84e-246	5	476	7	477
BBK22869.1	1.98e-245	5	476	7	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2XHY_A	8.31e-184	1	476	8	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	3.76e-175	1	476	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.07e-174	1	476	7	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
6WGD_A	1.38e-172	5	476	12	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
3PN8_A	8.69e-169	1	476	7	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	4.55e-183	1	476	8	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	1.62e-173	5	476	12	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	1.74e-171	5	476	11	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
P42973	2.14e-171	1	476	4	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P26206	4.32e-165	5	476	9	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000380_00890.