CAZyme Information: MGYG000000378_00614

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000378_00614
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304	MGYG000000378_8|CGC3	35363.72	8.5574

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000378	2604862	MAG	Sweden	Europe

• Gene Location: Start: 43694; End: 44608 Strand: -

Full Sequence      

MTADVIIPVYRPDARLKESLRRLEAQTVKPTKIILMNTEERYFDPSVMDGISHIEVHHLT
KEEFDHGKTRHEATAWSQADILIFMTQDALPKDKYLIEHLIRPIEEGKASISYGRQLAAP
DCRELERYTRQFNYPVESCYKTAADLPRLGIKTFFCSDVCAAYLRKDYDAFGGFIRKTIF
NEDMILAGNMIKSGKTVAYAADARVIHSHNYTGLMQFHRNFDLAVSQADHPEIFEGIRSE
TEGIRLVKETARHFLKEGKPWILVELVWKSGWKFLGYRLGKQYRRLPGWMIRMCTMSPSY
WEKQ

Enzyme Prediction     

No EC number prediction in MGYG000000378_00614.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	168	5.5e-16	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00535	Glycos_transf_2	4.36e-11	4	166	1	162	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	4.14e-07	5	119	1	118	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG0463	WcaA	1.28e-06	1	219	3	211	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
COG1216	GT2	1.55e-06	5	212	7	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam13641	Glyco_tranf_2_3	0.001	5	209	6	213	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBE96877.1	1.43e-126	2	301	5	304
QMW79879.1	1.43e-126	2	301	5	304
QIB57343.1	1.43e-126	2	301	5	304
QRT31229.1	1.92e-124	2	303	6	307
QHB25127.1	1.92e-124	2	303	6	307

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26403	1.64e-53	1	302	1	303	O antigen biosynthesis rhamnosyltransferase RfbN OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbN PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000378_00614.