CAZyme Information: MGYG000000373_02443

Basic Information

• Species: UMGS1537 sp900761045
• Lineage: Bacteria; Firmicutes_A; Clostridia; UBA1212; UBA1255; UMGS1537; UMGS1537 sp900761045
• CAZyme ID: MGYG000000373_02443
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
797		90878.38	5.0472

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000373	2809464	MAG	Sweden	Europe

• Gene Location: Start: 717; End: 3110 Strand: -

Full Sequence      

MRAEWIWTDHRLAADPRMIYFKKEVRLPDQEMPLACRLRICADSRYLLTINGRRVMTGPC
RAPRGVRYTDELDVTAYLRPGENEIFVKVIQYPDHKEKNICFLTGPSSVVTEGIGGLWIE
ELETSYGFSTSAQYFCTEVSGYAFRENHRYGYIGFLEDFDGRLVTEQTPDAIWKPAVVIA
GYPTEGIGALRDYWTTEPRPIPYPFETEDSFRRVMRSGGLLVESGGERFVPAGCTAFLEL
DAGRLVSAYPRFVFRCGSGSRLRVVYAEGYGVLQQNGSFLRGVRDNPEGQTLFGLTDLYT
AHEGRQTYLPFFYRSFRFVRVEITASEDQPFFLERADYLKTGYPLEITGTFYANDERFEE
IWKISKRTLLCCMYETYMDCPYYEQMQYIMDTFLEIRYTLCISGDGRLARKAIDDFARAQ
LWDGLLPCNSPSKFQQMIPGFPFYWILMLDTYMMYLGDRPFLRSHLGTLEKLLHYYESRV
NEDGLLGDTGYWQFFDWVKEWENGSPVRKGEINILYNLLYVYALRTAAGIYRFCMRPDTA
LEYEARAESVAAAVRRSAYDTETGLFCDAPGRRPSSQHAQIFAVLASAVPEEEKRPLMER
MLANRDQLCVPSYCMSYFLCRALEAAGLYDEIHSTLKIWDAFIDLMELHLTTWPEDFVTM
RSDCHGWSAFALYEFAACYLGVRPLEPGYAKIGIVPQPCPLTSYGGTVPVGDRGLVSIAF
EKDASGCTAVRVSLPEGAECIHDFSLISGAPVDIRTETEQTADGVPRAKGKQEIFRHGSD
LHGEGKETVRLSSKGGE

Enzyme Prediction     

No EC number prediction in MGYG000000373_02443.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	240	740	7.9e-95	0.9702380952380952
CBM67	3	183	6.4e-20	0.9715909090909091

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.77e-24	348	603	3	252	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
PRK10340	ebgA	0.002	42	94	135	182	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam06202	GDE_C	0.002	391	568	34	220	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
pfam05592	Bac_rhamnosid	0.002	240	331	10	92	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam02837	Glyco_hydro_2_N	0.005	20	94	68	138	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK59208.1	5.06e-171	1	736	3	746
QJD82735.1	1.41e-154	3	724	13	745
QTH41582.1	1.93e-154	3	755	9	772
QNK56541.1	5.97e-148	2	736	9	773
QTH40607.1	4.75e-142	3	737	9	760

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2OKX_A	6.93e-42	152	739	380	936	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000373_02443.