CAZyme Information: MGYG000000366_01035

Basic Information

• Species: UMGS882 sp900757905
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882; UMGS882 sp900757905
• CAZyme ID: MGYG000000366_01035
• CAZy Family: GH63
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		56964.14	5.3412

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000366	2815847	MAG	Sweden	Europe

• Gene Location: Start: 12758; End: 14254 Strand: -

Full Sequence      

MYEFHQNMEITYVNSPYVEKNPFLSVQTHKAALPAYDSARSLVPEIVWDGHEDAVACYNK
AWQIAFSNLNNPTDGSGFVSPFIDTAFNGNLFMWDSSFILMFAKYASRAFDFQQTLDNFY
SHQHKDGFISREIREKDGAEVYARLDPSSTGPAILSWCEYEYYLYSGDKSRLKDVYYPLL
AYHLWMKKQRTWRDGTYFLSGLGCGMDNSPRQEPGCNPRYEHGHMVWIDACFQALIDCDM
LIKIAAIAGIDEGVSELQTEKETLGAYINDRLWDEKTGFYYDMYRDNRLSGVKTVASFWS
LLSGIVPESRIERLVAHLENENEFKRPHRVPSLSYDHPAYHPDGDYWRGSVWAPTTYMVL
RGLDRNGYHKQAYDIACNTVENVVKVFAETGTLWENYAPEKAARGNCAKSDFVGWTGLVP
ISMLIEYVFGIRCNALDKTVTWDIRMDGEYGVQNLSFADVTASFLHKADGTVEIKTDKTI
SVKLIKNGKTEIRTCTPE

Enzyme Prediction     

No EC number prediction in MGYG000000366_01035.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	86	418	1.3e-34	0.35964912280701755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	5.74e-18	241	403	591	762	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	1.24e-15	92	423	93	492	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG3408	GDB1	8.70e-15	93	441	290	620	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	3.23e-12	243	427	320	508	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG1626	TreA	4.45e-07	241	432	367	557	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN83484.1	7.36e-182	11	494	10	506
AIQ57834.1	2.68e-169	12	457	7	452
QHT63246.1	1.70e-166	11	459	29	480
QHT63247.1	1.74e-163	12	457	28	476
CBW22282.1	9.48e-158	3	485	29	515

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7T66_A	1.27e-16	166	419	555	807	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
3W7S_A	2.56e-10	228	404	551	736	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.56e-10	228	404	551	736	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
6XUX_A	2.75e-10	228	404	100	285	ChainA, Nanobody,Glucosidase YgjK,Glucosidase YgjK,Nanobody [Escherichia coli K-12]
7PQQ_B	2.75e-10	228	404	100	285	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	5.70e-35	96	456	62	419	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
P42592	1.42e-09	228	404	574	759	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
Q13724	1.23e-07	92	427	448	837	Mannosyl-oligosaccharide glucosidase OS=Homo sapiens OX=9606 GN=MOGS PE=1 SV=5
P49381	3.59e-07	252	397	535	678	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
F4HTM3	8.61e-07	297	427	705	849	Mannosyl-oligosaccharide glucosidase GCS1 OS=Arabidopsis thaliana OX=3702 GN=GCS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000366_01035.