CAZyme Information: MGYG000000353_01189

Basic Information

• Species: UBA7173 sp900548705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900548705
• CAZyme ID: MGYG000000353_01189
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377	MGYG000000353_8|CGC3	41382.33	4.6455

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000353	2738445	MAG	Sweden	Europe

• Gene Location: Start: 64702; End: 65835 Strand: +

Full Sequence      

MKLFHILAATLAATAITGCGGSATNTADTVADSVATPAQELLQRLQKVQDAGLTIYGHDD
DPVYGVNWFGDEGRSDVLETAGDYPGMMHWDLGLIEVSSALNLDSVAFDRMAREMALQDK
RGGINAISWHPLNPHTGKDAWQPVDTDVVTLAVTPGTAENDTLKVWLGRAADYLASIKNE
AGEPIPLIFRPWHEMSGGWFWWGGPNTTVESYRKLWDMTREAFDARGLDNILYAYSPDVV
GSKEEYMTWYPGDDKVDILGADVYHRDGAEGTDRWFASIDSTYGSAVAVAAEKGKIAALT
ETGCEGLPVEDWYTSCLLPVIRKYHPVYVTVWRNGNATLHRPGHFYAPYPGHGGVESFKT
FHADSLTVFAKDMAAIR

Enzyme Prediction     

No EC number prediction in MGYG000000353_01189.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	34	303	1.4e-55	0.8151815181518152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	2.05e-30	75	296	43	263	Glycosyl hydrolase family 26.
COG4124	ManB2	5.08e-16	133	307	123	300	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD38980.1	5.51e-117	5	369	3	363
QCP72670.1	5.51e-117	5	369	3	363
CEA16909.1	1.09e-107	38	373	43	373
SCD21901.1	1.54e-107	38	373	43	373
QRX64949.1	2.85e-103	39	373	39	368

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	5.73e-88	18	372	1	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
4CD4_A	1.67e-66	1	373	6	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX5_A	2.54e-66	32	373	35	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
2VX4_A	2.54e-66	32	373	35	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX7_A	1.98e-65	32	373	35	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.88e-39	32	376	51	414	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.78e-33	74	306	84	321	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	1.51e-20	120	267	121	271	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	9.43e-20	120	267	119	269	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P16699	1.19e-17	121	275	123	281	Mannan endo-1,4-beta-mannosidase A and B OS=Caldalkalibacillus mannanilyticus (strain DSM 16130 / CIP 109019 / JCM 10596 / AM-001) OX=1236954 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000047	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000353_01189.