CAZyme Information: MGYG000000348_00691

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000000348_00691
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000000348_8|CGC1	53681.15	5.0841

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000348	2655711	MAG	Sweden	Europe

• Gene Location: Start: 72810; End: 74267 Strand: -

Full Sequence      

MNFDNFIKRATLRLGALTVITVMGATACGAEKNEPNNPDTTKPEVGATANTSRAIEIIDA
AVDNYFKGPGMAMSRYYNPYTGKASDEIGSVWMYTSSIEAVNAVLNSLNALKAEGKPELY
DANFSRYATLLDNLVDNLEFYAGTYELTSYTGTNTWTVYGVNRGAGKGSADVTGVLNVYD
DQMWLVRELLDAYEATGKDAYLKKAEYLTAYVLDGWDCTLDANGKQNGGITWGPGYVTKH
SCSNGPMVTPLVKLAQIYKGKSDPITYGVINPDKTRAKQTKAKADYYLEMAKAVYDYQKS
HLYDESTGVFVDMMGNDDNGGQIRYEEIDGVRYRGHVALSAAVGERYSYNTGTMVSGAAS
LYEATKDNVYLEDLKNYADRSFAYFAKPVNSKPGCYEMPLTGFNNWFNCVLLRGYADAVK
AYPKAAEYAKAYQNNLDYAYSNHLYNHMLPPSLLAGWNTSRDRNNMEAMFTFAFATEYAV
LQALK

Enzyme Prediction     

No EC number prediction in MGYG000000348_00691.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	73	443	1e-41	0.7988826815642458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03663	Glyco_hydro_76	1.67e-16	179	427	86	300	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBK85776.1	6.02e-191	7	481	3	476
QPH58159.1	6.02e-191	7	481	3	476
QUT64972.1	7.69e-191	17	481	10	473
QBJ17832.1	1.40e-189	7	481	3	476
QUT62205.1	5.48e-187	14	481	7	477

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4C1S_A	5.38e-13	53	485	6	371	Glycosidehydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],4C1S_B Glycoside hydrolase family 76 (mannosidase) Bt3792 from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6SHD_A	3.01e-08	177	373	131	281	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	2.19e-07	177	373	132	282	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
4V1S_A	5.17e-07	179	408	142	325	Structureof the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],4V1S_B Structure of the GH76 alpha-mannanase BT2949 from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
6SHM_A	6.77e-07	184	373	140	282	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000018	1.000021	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000348_00691.