CAZyme Information: MGYG000000346_01259

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000346_01259
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000000346_234|CGC1	42004.89	4.6645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000346	2294646	MAG	Sweden	Europe

• Gene Location: Start: 1892; End: 2995 Strand: +

Full Sequence      

MKDLVYKDHTALDYAKMACDTLMKKFDAPDLPPKGRFHYHQGVFLSGMQKTYDICQEEQY
YDYIKAWVDSIISEDGTITEFDKGQLDDIQPGVLLFELYKKSGDERYKKALFTLLPLIKN
FPKNSEGGFWHKVNNPEQMWLDGLYMAGPISAEFAATFDQPEYFDICAFQALLMEKKTKD
PETGLWYHAWDAKKVQPWADPETGLAPEFWGRSIGWVPVAILEELDFLPQDHKDRQELIR
LTTDLLKSIAKFQDKESGLWYQVVNKMGQEGNWLESSCTCLYVAAMCKAVKAGYLDESYL
EIAELGYKGIINRLKYNENGVIIDNICVGTGVGDYAFYCARPTSENDLHGAGAFILMCTE
VYKAFHE

Enzyme Prediction     

No EC number prediction in MGYG000000346_01259.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	32	363	2.4e-110	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.94e-118	9	365	6	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	8.91e-113	14	365	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ92567.1	4.37e-206	10	361	4	355
BCJ93957.1	4.16e-168	7	364	5	363
QNF30158.1	1.52e-167	10	364	17	371
QNK55786.1	2.31e-167	10	364	9	363
AFH61356.1	1.21e-165	10	364	9	363

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1NC5_A	2.98e-117	12	367	14	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.22e-116	12	367	4	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4WU0_A	3.07e-87	14	360	4	357	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
3QWT_A	9.55e-26	1	365	26	380	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	3.83e-23	37	365	66	381	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.63e-116	12	367	14	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.69e-21	146	360	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.69e-21	146	360	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
P9WF04	5.52e-06	125	361	184	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000346_01259.