CAZyme Information: MGYG000000345_01619

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_01619
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
388	MGYG000000345_8|CGC3	43286.14	9.8557

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 92766; End: 93932 Strand: +

Full Sequence      

MNPTRKEIWIVAGEASGDLYGARIAAELKRRRPDVVICGMGGVEMRKAGVELLVDSSELG
VIGLVEVLENLLKFIRILLYLIREAEKRRPLEVILIDYPGFNLRFAKAMWKAGIPVVWYI
SPQVWVWRHGNIRKLAKYCRKLLVIFPFEPEVYNGSGLDVEFVGHPLVDIVRGRADATIE
RDPNTILLLPGSRKKEIEYLLEPFLRTAVLLKSRHPAFQFVIVSPRERILQMVKEGLEKF
RKANPGTLLPPIQLTRGKAAFWMQRCAAGLAASGTVTVECAIAGLPLVVAYKLNKLTFLL
ARIIIGKLFRGFFTMPNIILNRCVFEEFLQHQVIPEDLADALERILPGGERHDQVSADMQ
EMVEQLSGGANGAIGKAAASALSVIGKS

Enzyme Prediction     

No EC number prediction in MGYG000000345_01619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	8	366	8.4e-108	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.93e-124	8	388	4	378	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.88e-109	6	382	2	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.45e-85	8	366	1	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.77e-81	1	382	1	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.18e-45	6	344	2	315	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	1.68e-142	1	378	1	379
AVM45461.1	2.51e-126	5	381	11	387
QHI67954.1	1.57e-74	5	346	2	338
QQG66459.1	3.38e-74	4	385	12	391
ADW17729.1	7.04e-73	6	385	9	387

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.02e-44	8	366	9	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.43e-44	8	366	9	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2LVL8	1.84e-69	6	388	4	381	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	4.04e-68	6	369	7	366	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
A0L8R9	5.09e-67	8	346	7	343	Lipid-A-disaccharide synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=lpxB PE=3 SV=1
Q1D393	3.80e-65	2	385	3	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
B8JE78	5.35e-65	7	346	10	345	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_01619.