CAZyme Information: MGYG000000338_00166

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_00166
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
794	MGYG000000338_3|CGC1	90124.65	9.5316

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 20888; End: 23272 Strand: -

Full Sequence      

MISKLIGHKLTTALIALGCVFSLSLAAPWQEAYAASSNNNTSVKSQKASTKAASKASAKT
SAKSGAKASAKKSTASKSTKAKKSTAKTSKSSKSSNSSKSAKSSKAVKAAAAAAAVGAAG
AALANQYVESKVDPYMITSYAKEMDRINADLSLDSFNKMPKSRISKMREAYVQAENAFKR
GDEALGFKIQKEQLEGYPLNIWLTYFYLGYNIRPEKFEAALAFIQSNKQSELSSLLKDRY
AAYLSNERDYERLARLIGPKPFDESKLTTLSFNQKAQMCRFYEANWPLNKVNEDAITFAT
RVYLDLTKRPLSCNALISLFDAKGYLTDKLMLKRYENAYVLRYYQDTTNSLAKQLEHTSF
GDRVKVQMELYEEPGTLFEKITTNDEQAHRAAVLAFKRFANLSPLEARNNFDKFIKTYEP
SEAELVDIYQIFASSFLGRSFTLKDVLWVDKNLPAVAWSTQLKEQRLRRAIYFAQWDNVY
ILIDHLPQDLQKNINWRYWKGRAAYELGKTNEALGILEDVAKDRSFFGFYAAQALGVEYA
FNYVKIDPNFSFPMDIANNQAAIRFLELYALDDDDAIYEWREIAKRSPEHEAMVMAQWAL
QTGNVRYAIDFVVSSQKWDALDYRFPIAYKEMFEQYAQESQVPLSFLYGISRQESMLNHK
IKSWAGAVGLMQVMPGTARDIAKKEKWEFAGNASLLDPQTNIQYGSTYLKWMLEKFDNNR
VLAAAAYNAGPGRIPQWKSNDGIYRDAAMYIECIPFEETRKYVQNVLLYDAIYNFLITGN
KGELMRKSELSYIY

Enzyme Prediction     

No EC number prediction in MGYG000000338_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	642	769	2.4e-29	0.7851851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	1.30e-80	194	789	59	639	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.64e-67	624	776	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.27e-43	626	769	1	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	1.62e-36	495	773	2	283	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd00254	LT-like	2.20e-34	645	769	2	109	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATG74879.1	1.57e-75	165	794	21	635
QBG10097.1	5.21e-75	194	789	59	640
QLO38803.1	7.22e-75	194	789	59	640
QLT78323.1	7.22e-75	194	789	59	640
QLP25723.1	1.00e-74	194	789	59	640

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.03e-74	194	789	32	613	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	2.69e-73	194	789	32	613	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	1.31e-66	151	773	14	621	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FBT_A	6.29e-65	168	773	2	592	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.29e-64	166	773	1	593	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.01e-73	194	789	59	640	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.01e-73	194	789	59	640	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	2.55e-71	194	789	59	640	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	2.18e-43	361	794	163	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.37e-17	622	766	57	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000494	0.998727	0.000217	0.000200	0.000169	0.000147

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_00166.