CAZyme Information: MGYG000000323_00744

Basic Information

• Species: Enterococcus_D sp002850555
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_D; Enterococcus_D sp002850555
• CAZyme ID: MGYG000000323_00744
• CAZy Family: CBM50
• CAZyme Description: Vitamin B12 import ATP-binding protein BtuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MGYG000000323_2|CGC3	39573.96	9.7016

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000323	3361404	MAG	Sweden	Europe

• Gene Location: Start: 145402; End: 146457 Strand: +

Full Sequence      

MKKVEKEIKVRATLVTKEYDLYKKKADKVKALFKFYHRNVPRFWALKGVSFDVKAGESVG
IIGINGSGKSTLSNVISGIIPPTSGTMEVNGDTSIIAIGAGLKYQLTGLENIRLKALMSG
MTNKEIDEKMPEIVAFADLGDFINQPVKSYSSGMKSRLGFAIAVHNDPDILVIDEALSVG
DETFYQKCVDKIMEFKAAGKTIFFVSHALGQVEKLCDRTIWMHYGDLRMFGPTEEVMAEY
RKFIDWFKKQPKKEQKAYQDNYKEDQKAFNLEKLAEKSREDHFLQQQNLSDQMIQKNLKR
TPLGEKMSWLTKGILGLVVAATIFCSLVSFSGRSITYAIKNPVETISQVFK

Enzyme Prediction     

No EC number prediction in MGYG000000323_00744.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1134	TagH	8.15e-113	7	251	1	249	ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd03220	ABC_KpsT_Wzt	4.34e-104	10	231	1	224	ATP-binding cassette component of polysaccharide transport system. The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export. Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters. A typical system is made of a conserved integral membrane and an ABC. In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenza) and a cytoplasmic membrane protein MPA2.
PRK13545	tagH	1.21e-98	9	260	4	254	teichoic acids export protein ATP-binding subunit; Provisional
PRK13546	PRK13546	8.38e-98	6	267	1	261	teichoic acids export ABC transporter ATP-binding subunit TagH.
COG1131	CcmA	2.12e-51	28	295	6	289	ABC-type multidrug transport system, ATPase component [Defense mechanisms].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBD25608.1	4.73e-118	4	350	1	348
AUC58829.1	4.73e-118	4	350	1	348
QPB60328.1	4.73e-118	4	350	1	348
AYZ07349.1	4.73e-118	4	350	1	348
QCJ67441.1	4.73e-118	4	350	1	348

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7DD0_A	1.58e-115	8	269	3	267	Crystalstructure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_B Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_C Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168],7DD0_D Crystal structure of the N-terminal domain of TagH from Bacillus subtilis [Bacillus subtilis subsp. subtilis str. 168]
6JBH_A	2.17e-90	15	260	10	254	Cryo-EMstructure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius],6JBH_B Cryo-EM structure and transport mechanism of a wall teichoic acid ABC transporter [Alicyclobacillus herbarius]
6AMX_A	1.45e-64	10	242	1	233	CrystalStructure of Nucelotide Binding Domain of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_A Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6AN5_B Crystal Structure of The Nucelotide Binding Domain of an O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_A Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5],6OIH_B Crystal structure of O-antigen polysaccharide ABC-transporter [Aquifex aeolicus VF5]
6M96_A	4.35e-64	10	242	3	235	ATP-boundconformation of the WzmWzt O antigen ABC transporter [Aquifex aeolicus VF5]
7K2T_A	2.05e-62	10	244	3	237	ChainA, ABC transporter [Aquifex aeolicus VF5],7K2T_C Chain C, ABC transporter [Aquifex aeolicus VF5]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03SI5	7.61e-128	9	342	6	341	Teichoic acids export ATP-binding protein TagH OS=Levilactobacillus brevis (strain ATCC 367 / BCRC 12310 / CIP 105137 / JCM 1170 / LMG 11437 / NCIMB 947 / NCTC 947) OX=387344 GN=tagH PE=3 SV=1
Q88ZH4	2.33e-122	4	349	1	349	Teichoic acids export ATP-binding protein TagH OS=Lactiplantibacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) OX=220668 GN=tagH PE=3 SV=1
Q831L8	1.34e-118	4	350	1	348	Teichoic acids export ATP-binding protein TagH OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=tagH PE=3 SV=1
Q8Y843	1.59e-115	4	267	1	264	Teichoic acids export ATP-binding protein TagH OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) OX=169963 GN=tagH PE=3 SV=1
Q92CV8	3.42e-115	6	268	3	265	Teichoic acids export ATP-binding protein TagH OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=tagH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
308	330