CAZyme Information: MGYG000000322_00524

Basic Information

• Species: Odoribacter sp900544025
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900544025
• CAZyme ID: MGYG000000322_00524
• CAZy Family: GH101
• CAZyme Description: Endo-alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
982	MGYG000000322_7|CGC1	112270.96	7.6803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000322	3470887	MAG	Sweden	Europe

• Gene Location: Start: 63453; End: 66401 Strand: +

Full Sequence      

MKKIILLGILLAGIYPGIGYWAGYAQNAREFRTENIGSQEMTVTVDADFPRAIEYRLGGK
LFRGAMSPERQVMVNGKPQPARIVFRKEGENRVVYDFTFDKIELSFSVELVVRGKVLEGR
VNRIKEGQDKLYTLAFPGQQLLTVAMTDKAPAYIWCRMIPMKDAPDVYQTLRESSPDGSA
RTANYLFLENGELAAGILSNVIDERERVAFQVKQIAGNKVCQAWCPVWTYRELATETLEM
PWFKVVIADDGNRDGIVDWQDAALLYRAEVKRPFRSEEVKTIVSSQIGFNASHLAENPFL
RMFDNMKKCALLLDFLPQDLLVKGFQGGGHDSSFPDYAHPNRQAGGFRDLNYMIDHGEEI
GLKVGLHINCTEAYPESRYFDPSILTKELGWLWGDQAILIDKKKDLKSGKLFQRMDEMFD
SVPNIDFLYVDTYQDRGWPLIKINEKLVTHRQRMYTEFDAAMDGVSTWSHGRTRLKGKVA
RFIWNDCRDIFGLDPLLLGAEHHGINGWEGEASVPRFVKEVYTRNLPTKFLQHFRLMRWT
EQEAVFDGGVKMERQGNRVKGVWGNSTFFSGLWDEQRKSFKEIKVFVPWEPLTEQPGRIF
AWDETGGTGHWVLPDSWKKIKKVYVYKLTDRGRVFERSVPVNGRAVDYTFEKETPYVFYA
RKVQEIDPAVMKWGDGQEIGDPGFNDYTLSSWEKTGDKRAVRVERDRNGQTSLQLAAGKV
AGVSQRIGALQPGAAYFVSTRVLIDGKADRRTELQVEALQKGKAVHTVKNYLDNTALNGA
TGWQRLRVWFEVPAGTDDVRIGIRSEAGTAGTVVWVDDVKAYRTTPVAKEADCVLWEDFE
LRDIGWGPFVNTVKGSIYTDLSEFNPGRTADVIDGHFSLKTWNQKKGLLYRTVPGLLRLS
PEQKYEIEFDYLCDRDNSYELIIKESDRPEARVLLREPIERGKGRVKKEFSTTRYPDAWI
GIEKTNNDSVIFVMDNLKLFIR

Enzyme Prediction     

No EC number prediction in MGYG000000322_00524.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH101	38	546	1.5e-102	0.8005657708628006

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14244	GH_101_like	3.28e-69	273	541	1	298	Endo-a-N-acetylgalactosaminidase and related glcyosyl hydrolases. This family contains the enzymatically active domain of cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins (EC:3.2.1.97). It has been classified as glycosyl hydrolase family 101 in the Cazy resource. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae and other commensal human bacteria is largely determined by their ability to degrade host glycoproteins and to metabolize the resultant carbohydrates.
pfam12905	Glyco_hydro_101	3.54e-68	260	510	1	265	Endo-alpha-N-acetylgalactosaminidase. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by the S. pneumoniae protein Endo-alpha-N-acetylgalactosaminidase, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor.
pfam18080	Gal_mutarotas_3	5.27e-38	36	259	1	243	Galactose mutarotase-like fold domain. This domain is found in endo-alpha-N-acetylgalactosaminidase present in Streptococcus pneumoniae. Endo-alpha-N-acetylgalactosaminidase is a cell surface-anchored glycoside hydrolase involved in the breakdown of mucin type O-linked glycans. The domain, known as domain 2, exhibits strong structural similarlity to the galactose mutarotase-like fold but lacks the active site residues. Domains, found in a number of glycoside hydrolases, structurally similar to domain 2 confer stability to the multidomain architectures.
pfam17451	Glyco_hyd_101C	1.21e-14	524	634	1	111	Glycosyl hydrolase 101 beta sandwich domain. Virulence of pathogenic organisms such as the Gram-positive Streptococcus pneumoniae is largely determined by the ability to degrade host glycoproteins and to metabolize the resultant carbohydrates. This family is the enzymatic region, EC:3.2.1.97, of the cell surface proteins that specifically cleave Gal-beta-1,3-GalNAc-alpha-Ser/Thr (T-antigen, galacto-N-biose), the core 1 type O-linked glycan common to mucin glycoproteins. This reaction is exemplified by a S. pneumoniae protein, where Asp764 is the catalytic nucleophile-base and Glu796 the catalytic proton donor. This domain represents C-terminal the beta sandwich domain.
pfam17974	GalBD_like	2.37e-08	837	969	26	176	Galactose-binding domain-like. Proteins containing a galactose-binding domain-like fold can be found in several different protein families, in both eukaryotes and prokaryotes. The common function of these domains is to bind to specific ligands, such as cell-surface-attached carbohydrate substrates for galactose oxidase and sialidase, phospholipids on the outer side of the mammalian cell membrane for coagulation factor Va, membrane-anchored ephrin for the Eph family of receptor tyrosine kinases, and a complex of broken single-stranded DNA and DNA polymerase beta for XRCC1. The structure of the galactose-binding domain-like members consists of a beta-sandwich, in which the strands making up the sheets exhibit a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQT68159.1	1.27e-185	33	982	25	983
AQT69519.1	3.42e-162	36	925	51	930
AZN39795.1	3.65e-150	25	975	197	1143
QHW33475.1	8.62e-142	33	975	254	1203
AQT69033.1	1.32e-139	36	977	23	1144

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6QEP_A	8.54e-105	33	979	9	1113	EngBFDARPin Fusion 4b H14 [Bifidobacterium longum]
2ZXQ_A	1.08e-104	33	979	24	1128	Crystalstructure of endo-alpha-N-acetylgalactosaminidase from Bifidobacterium longum (EngBF) [Bifidobacterium longum]
6QEV_B	1.21e-104	34	979	10	1113	EngBFDARPin Fusion 4b B6 [Bifidobacterium longum]
6SH9_B	1.21e-104	34	979	10	1113	EngBFDARPin Fusion 4b D12 [Bifidobacterium longum subsp. longum JCM 1217]
6QFK_A	1.21e-104	34	979	10	1113	EngBFDARPin Fusion 4b G10 [Bifidobacterium longum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9WNA0	5.15e-112	35	977	51	1032	Putative endo-alpha-N-acetylgalactosaminidase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) OX=288705 GN=RSal33209_1326 PE=3 SV=2
Q2MGH6	1.76e-75	34	979	332	1415	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_0368 PE=1 SV=1
Q8DR60	4.23e-75	34	979	332	1415	Endo-alpha-N-acetylgalactosaminidase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=spr0328 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.770890	0.175938	0.049391	0.000877	0.000511	0.002401

TMHMM  Annotations     

start	end
5	24