CAZyme Information: MGYG000000321_01448

Basic Information

• Species: Collinsella sp900549355
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900549355
• CAZyme ID: MGYG000000321_01448
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
185		21051.05	5.7219

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000321	1964511	MAG	Sweden	Europe

• Gene Location: Start: 1; End: 558 Strand: -

Full Sequence      

MRICLVLEGCYPYVHGGVSTWMHGYIQAMPEHEFVLWVIGAHAADRGKFVYELPGNVVEV
HEVFLDDALRLSGEQHEASFNDREREALRRLVSLSNPDWDVLFDIFHRRRVHPLSFLQSR
TFMDIFRDVCLAEYPYTPFADAFHTMRSMLLPVLYLLGSEVPVADVYHAISTGYGGPGPP
PGAWG

Enzyme Prediction     

No EC number prediction in MGYG000000321_01448.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam11997	DUF3492	1.92e-61	1	174	1	183	Domain of unknown function (DUF3492). This presumed domain is functionally uncharacterized. This domain is found in bacteria, archaea and eukaryotes. This domain is typically between 259 to 282 amino acids in length. This domain is found associated with pfam00534. This domain has two conserved sequence motifs: GGVS and EHGIY.
cd03813	GT4-like	3.95e-41	2	174	1	184	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria, while some of them are also found in Archaea and eukaryotes.
NF038011	PelF	1.46e-26	3	174	2	184	GT4 family glycosyltransferase PelF. Proteins of this family are components of the exopolysaccharide Pel transporter. It has been reported that PelF is a soluble glycosyltransferase that uses UDP-glucose as the substrate for the synthesis of exopolysaccharide Pel, whereas PelG is a Wzx-like and PST family exopolysaccharide transporter.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH69725.1	1.66e-126	1	176	1	176
QIA33154.1	1.34e-125	1	176	1	176
ATP53448.1	2.19e-124	1	176	1	176
QGM61945.1	3.81e-101	1	176	1	176
AIF91039.1	2.87e-98	1	176	1	176

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000321_01448.