CAZyme Information: MGYG000000316_01536

Basic Information

• Species: UBA945 sp900549675
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA945; UBA945 sp900549675
• CAZyme ID: MGYG000000316_01536
• CAZy Family: GH94
• CAZyme Description: Cellobiose phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
372	MGYG000000316_212|CGC1	41942.29	4.9654

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000316	2303090	MAG	Sweden	Europe

• Gene Location: Start: 2608; End: 3726 Strand: -

Full Sequence      

MVPFDNDVNTARPLMEHLKRSFDYIVNHKGPHELPLIGRADWNDCLNLNCFSKHPGESFQ
TFGPSEGPVAESIFIAGMFVKYGLEYAELCELTNSQQEAEYVKAEVDKMYRAVLKSGWDG
KWFLRAYDAFGEKVGSQECKEGKIYIEPQGFCVLAGIGVEEGYAQTALDSAKEYLDTDYG
MMILQPAYTEYHLELGEISSYPPGYKENAGIFCHNNPWVSIAETVVGRGDRAFEIYRKTC
PAYLEDISELHRTEPYVYSQMIAGRDAKFHGEAKNSWLTGTAAWTFVNISQYILGVYPTH
HGLQINPCIPNGFGDFKITREYRGVCYHIEVHNPNQVQKGISSLEVDGQSIKGNIIPYDK
EKENVNVVVTMG

Enzyme Prediction     

EC	2.4.1.20	2.4.1.49

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17167	Glyco_hydro_36	5.15e-133	1	296	151	424	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.
COG3459	COG3459	1.54e-116	2	370	695	1051	Cellobiose phosphorylase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM04267.1	2.94e-226	1	372	440	811
CBK73469.1	5.43e-219	2	371	441	810
QFJ54945.1	7.70e-219	1	371	440	810
ADL35180.1	1.80e-208	1	372	447	817
AWY99192.1	1.71e-207	2	372	441	811

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	1.69e-168	2	372	441	811	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3RRS_A	6.79e-147	2	371	448	822	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3S4C_A	5.37e-146	2	371	448	822	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
2CQS_A	1.79e-142	2	371	468	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACT_A	1.99e-141	2	371	468	842	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B9K7M6	3.86e-181	2	372	442	813	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.07e-67	1	372	451	801	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	2.61e-61	16	372	464	800	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q8P3J4	2.31e-25	11	348	451	773	Cellobionic acid phosphorylase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=XCC4077 PE=1 SV=1
Q7S0S2	3.10e-25	14	335	448	757	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000316_01536.