CAZyme Information: MGYG000000312_01258

Basic Information

• Species: Eisenbergiella sp900539715
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Eisenbergiella; Eisenbergiella sp900539715
• CAZyme ID: MGYG000000312_01258
• CAZy Family: GH105
• CAZyme Description: Phosphoglycolate phosphatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
549	MGYG000000312_10|CGC1	63385.96	4.5024

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000312	2782709	MAG	Sweden	Europe

• Gene Location: Start: 63791; End: 65440 Strand: +

Full Sequence      

MKQKKNLIIFTDSGDTIIDEATQRFDGDGIVTDADFIEDAGEVLKQLYEEGYRIALVADG
EESSFQNVYMKNGLKGCFEGWTVSETVGVQKPERAMFEDAMEQMGLSDADKSRIVMIGNN
LAKDVAGANRFGITSVWLDWSPRYFHEYREADWKPDYIVHHPSELPALLEQLDKKCGKEE
EIMKNQGQEAERKLELLIRAFTPILYEDDDIFMENMRKKKHVSEEELKKYAHWEWTQGVG
LYGLWKLFDATKKEEYLELLIRFYDNQMKVGFPPLNVNTMAPYLVMSNVAEYLHREDYME
PCREAARWIMEEMPRTQEGGIQHQTSDDENDQELWDDTLFMTVLFLANMGRILNRKDYCE
EAEYQFLLHMKYLQDSETGFWYHGWTFLERNHFAGAFWARGNCWLTVAIPELLAMIECSE
PVKRILQGALENQVKALAEVQADSGMWHTLLDDPQSYEEASGTCGFAYGILRGIHTGVLD
EKWLPVAEKAMEPILNLISEEGVLGQVSYGTPMGRKSRDFYKEIPIRPMPYGQALAILLL
VEERNGGKR

Enzyme Prediction     

No EC number prediction in MGYG000000312_01258.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	226	542	1.1e-101	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	1.07e-109	225	542	26	348	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	5.82e-100	216	542	10	338	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1011	YigB	1.49e-18	38	172	102	229	FMN phosphatase YigB, HAD superfamily [Coenzyme transport and metabolism].
PRK09449	PRK09449	3.94e-17	71	169	130	222	dUMP phosphatase; Provisional
cd04305	HAD_Neu5Ac-Pase_like	1.27e-14	8	138	2	108	human N-acetylneuraminate-9-phosphate phosphatase, Escherichia coli house-cleaning phosphatase YjjG, and related phosphatases. N-acetylneuraminate-9- phosphatase (Neu5Ac-9-Pase; E.C. 3.1.3.29) catalyzes the dephosphorylation of N-acylneuraminate 9-phosphate during the synthesis of N-acetylneuraminate; Escherichia coli nucleotide phosphatase YjjG has a broad pyrimidine nucleotide activity spectrum and functions as an in vivo house-cleaning phosphatase for noncanonical pyrimidine nucleotides. This family belongs to the haloacid dehalogenase-like (HAD) hydrolases, a large superfamily of diverse enzymes that catalyze carbon or phosphoryl group transfer reactions on a range of substrates, using an active site aspartate in nucleophilic catalysis. Members of this superfamily include 2-L-haloalkanoic acid dehalogenase, azetidine hydrolase, phosphonoacetaldehyde hydrolase, phosphoserine phosphatase, phosphomannomutase, P-type ATPases and many others. HAD hydrolases are found in all three kingdoms of life, and most genomes are predicted to contain multiple HAD-like proteins. Members possess a highly conserved alpha/beta core domain, and many also possess a small cap domain, the fold and function of which is variable. HAD hydrolases are sometimes referred to as belonging to the DDDD superfamily of phosphohydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR00386.1	4.13e-153	183	545	1	362
ANU44854.1	4.13e-153	183	545	1	362
QEH70918.1	1.72e-151	186	542	2	357
BCJ96760.1	2.76e-148	182	542	1	360
QOV18383.1	8.68e-147	192	542	13	362

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3PMM_A	2.34e-96	190	542	23	376	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
3QWT_A	3.80e-91	190	542	22	375	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
4XUV_A	3.23e-83	186	542	2	367	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]
1NC5_A	1.02e-22	225	514	31	336	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	4.00e-22	225	514	21	326	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31521	1.01e-60	233	549	29	341	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1
O34559	5.56e-22	225	514	31	336	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	8.19e-13	219	509	80	380	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
Q8TWR2	1.47e-09	44	174	105	232	Glyceraldehyde 3-phosphate phosphatase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) OX=190192 GN=MK0970 PE=3 SV=2
P0A8Y1	1.07e-08	53	169	112	222	Pyrimidine 5'-nucleotidase YjjG OS=Escherichia coli (strain K12) OX=83333 GN=yjjG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000005	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000312_01258.