CAZyme Information: MGYG000000305_00134

Basic Information

• Species: RF16 sp900542355
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Paludibacteraceae; RF16; RF16 sp900542355
• CAZyme ID: MGYG000000305_00134
• CAZy Family: PL1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
596	MGYG000000305_1|CGC1	65525.1	4.619

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000305	2446714	MAG	Sweden	Europe

• Gene Location: Start: 136397; End: 138187 Strand: -

Full Sequence      

MKHFSFSILLLLLMHCAWCKAEVRAFPTAEGYGKNATGGRGGKVYYVTRLDDCSDDNLIE
GTLRWALRTGDDSPRTVLFQVCGTIYLTSKLKLAHPNITIAGQTAPGGGICIAGANIYVC
QPNIIIRYIRFRAGDIPTTNYPCLDVENTRNVIIDHCSFSWSMEECLTLYDCDSTTIQWS
VIGEGLYNSKHQKGARSYAMQWGGEHATMHHCLIANCVSRTPRFNGVRDEADLANGHHNH
DAQVDNEFVNNVIFNWGKRNSLYGGENDTTKNHDAEGNAVGYNRVYMVGNYFRCGPATQA
ANLSQRYFVQGSKKSDYGCWLLSGNQFELGNPNNAALPCWSDSVLRLVNADNLYGYTSGD
PNRAFNLDGLAADEQAYNRYVLSQPLNTSGIVAEDALQAYQSVVAAEPLRGAGASLPRYD
EQDLRMLQEAAGIIEPQFAGATKPAWKGIIDSQNDIRFSQMDCFFVGDSVATGYPYLDAI
EGDSLAQDTDADGLPDEYEIEIGLDPSDPADADLFAPSGYTYLETYLNGVADGIINKADY
EHLPYTSLQPSMPQALPEVNTRPSNTTGYDLLGRPCATPMPSIPYISDGKTYILLH

Enzyme Prediction     

No EC number prediction in MGYG000000305_00134.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	83	292	2.8e-64	0.9890710382513661

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00656	Amb_all	3.45e-06	97	224	17	151	Amb_all domain.
COG3866	PelB	3.61e-05	37	223	49	235	Pectate lyase [Carbohydrate transport and metabolism].
pfam18884	TSP3_bac	0.007	488	509	1	22	Bacterial TSP3 repeat. This entry contains a novel bacterial thrombospondin type 3 repeat which differs from the typical consensus by containing a glutamate in place of one of the calcium binding aspartate residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT75604.1	2.82e-140	25	532	38	534
QDT03682.1	4.19e-89	21	530	44	476
QDV25199.1	1.30e-88	25	530	28	456
CAD74167.1	9.49e-88	25	530	28	454
ALJ01754.1	1.30e-87	20	531	14	461

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FI2_A	4.42e-08	19	223	35	235	VexL:A periplasmic depolymerase provides new insight into ABC transporter-dependent secretion of bacterial capsular polysaccharides [Achromobacter denitrificans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B0XMA2	2.08e-37	25	530	23	414	Probable pectate lyase C OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyC PE=3 SV=1
Q4WL88	3.90e-37	25	530	23	414	Probable pectate lyase C OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyC PE=3 SV=1
B8NQQ7	8.87e-36	25	530	22	413	Probable pectate lyase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=plyC PE=3 SV=1
A1DPF0	1.23e-35	25	530	23	414	Probable pectate lyase C OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyC PE=3 SV=1
Q0CLG7	5.80e-35	25	530	22	413	Probable pectate lyase C OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=plyC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000659	0.964227	0.034492	0.000247	0.000180	0.000170

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000305_00134.