CAZyme Information: MGYG000000289_00823

Basic Information

• Species: Prevotella buccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella buccae
• CAZyme ID: MGYG000000289_00823
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MGYG000000289_7|CGC2	42582.47	9.0252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000289	3001000	MAG	Sweden	Europe

• Gene Location: Start: 95555; End: 96676 Strand: +

Full Sequence      

MKRIAILSVGVLMAVMAARAQKPAEVLAVAQRTNNYFMAKYSDPTVPTFVKKMRTSNLWT
RAVYYEGLMALHEIDADKRYLDYTDRWADFHKWTARNSIQTTNADDQCCEQTYIDRSVMA
GRAEWMAPTKVNLDHQMGLGKYDDWWWIDAIQMAMPIYAKYYKATGERRYIDFAMRSYRC
TRDTLAGGLFNKTEGLWWRDKNYKAPYKEPDGKNCYWSRGNGWVYGALVRVMQNLSPKDR
YYKELKADFVKMSEALLKVQRPDGFWNASLVSTNYEGPEVTGTSLFLYGMSWGINHGVLN
AKKYRAACDSAWKAMAGSVHADGFLGWNQGTGADPSTGQPVTYTSVPDFEDYGTGCFLLG
AAEYYRLLGAVRP

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	53	366	1.5e-72	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	8.39e-74	29	368	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	9.94e-42	59	368	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS85005.1	3.32e-181	1	367	1	365
AGB29883.1	3.26e-171	17	368	16	370
QVJ80547.1	6.91e-164	26	367	24	385
QIH37243.1	2.74e-133	25	368	26	371
VTR39274.1	2.28e-132	25	368	37	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5NOA_A	7.58e-55	24	368	31	375	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	5.07e-53	25	368	15	358	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
4CE7_A	1.01e-45	59	367	53	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
1NC5_A	2.25e-06	50	300	30	297	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	9.11e-06	50	300	20	287	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	7.79e-48	59	367	58	375	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	6.49e-45	59	367	60	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.18e-39	52	363	85	407	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000363	0.998881	0.000225	0.000179	0.000170	0.000152

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000289_00823.