CAZyme Information: MGYG000000287_03407

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_03407
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1359		149289.32	4.2607

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 5393; End: 9472 Strand: +

Full Sequence      

MRKKKRFKQAAAGMSALAIGASTILSAMAGIPAMAAGEQKTAGEIAVNPDIHYQTLNGWG
TSLCWWGNIIGSWGDADWNGNGRADREEIAELAFSPEYLNLNIVRYNVGGGDKENSSIKR
CEGLVPGWTEDMTGTKDGSGEFNSEAFYGKTTEEMSDAGQLWMLEQANKYRYDYAQQTGE
ENTIINKVFSNSPPYYMTKSGTSTGGYWNDPNNLKDDYYDDFAMYMARSANWVDQNLKSK
FGVGVSYIEPLNEPDTNYWHEGSTKQEGCIFNTGELQSRAYREMLNAMEAEEFQGNLKDV
KITGTDETSLWAGINSYNRLDDDIKSAMDTISVHTYSGSNSERKELRHIAEMYDKGLWMS
EVTKGGGSHYDGSHESMEAANTRSQSEGIMDDLKYMQPTAWIAWLVADSEYECLQTNSNW
GLIHAVFEKDGQPVPDYHTNLVDGNGNRKEGVPGEGYWAVTKQLYTMMQYSKYLKAGYTM
IDIQDSNMCAAISPEGDELVIVAQNFGGERNTSVDLSAFNTAATAELYRTSDSESCQLAE
TQDVTDGILDVTLPSNSVSTYIIRANDASAVCSPSDYAKVVDANVEKPAEDWTSDINKFT
YTGSWGNSAESFGGGKYTTAPEGLAEFTFEGTQAQIYGTMAPEGALVNISVDGGEQQEVS
LVSEDKEGGVLLYHTGLLEEGTHTISISKAAGQDGKLLEISNGRVIYGTLNEKVENISKS
EQVYTVSGVQPILPDTVTARTNMGNKLEMKVVWNLEGVDFTKNVTLEGTVSETAVKASVD
VQIIPENVQYFIDCNNPESPEYKRVNRYAELLNQSPDQKYEEGSWGYAEQYGAYNGDVND
NYDTGWYAKQGQQIRYVIPLEAGTYRVSMGFKEWWNQNRPMKVSVTAGGKTTELGTANTW
KNNNPWNEEYYEFTCEAAGEATLSVAANGGPDPVLSYIRIQNKLNLQELKDALTGARAID
RSQYPEEKLEVLDEAVKAGHPLLYHAGTSQKDAEQAALKIREALEGLNGGGETQETDLTS
LKLAIAMAEKLELQQNENKCFTEESWAAVEDALSLARAALEKPEATQDEVDRAFLKLITV
CNLLESTTQKTGLKAVIDGAEAILTDEESLAQYTEESVEAVRTALAEAKRVYTNEGVSQE
AVNEAARKLMDAVTGLLLKSEDTRLDILIQKAESILKNEAQYTPSSIAGLRTALEAAKAA
AENGKADVAEINQAYKDLAEAMTSLIRKGNKSELKNALDMADQILQNSKKYLESSISGLQ
ALTEEARKVYDDVESDAGRIGEVLKRLINEILKARLMGDTDLNGVVDTNDSAELLKYNAE
LRPFTEEQKQLGDVNGDGTADSGDAAVILQYAAEKIVSF

Enzyme Prediction     

No EC number prediction in MGYG000000287_03407.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	45	561	1.7e-122	0.9978070175438597

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.19e-20	45	405	4	354	O-Glycosyl hydrolase family 30.
cd14256	Dockerin_I	3.86e-10	1298	1351	2	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
COG5520	XynC	1.15e-09	187	566	117	431	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].
cd14255	Dockerin_III	2.26e-08	1298	1354	1	62	Type III dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents the atypical type III dockerins and related domains.
cd14253	Dockerin	6.24e-08	1298	1353	1	56	Dockerin repeat domain. Dockerins are modules in the cellulosome complex that often anchor catalytic subunits by binding to cohesin domains of scaffolding proteins. Three types of dockerins and their corresponding cohesin have been described in the literature. This alignment models two consecutive dockerin repeats, the functional unit.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWY99102.1	0.0	1	1330	1	1330
QIB57138.1	0.0	1	1359	1	1347
QMW80085.1	0.0	1	1359	1	1347
ADL05173.1	2.09e-288	27	1020	20	1270
QJU15030.1	7.74e-131	118	1015	302	1052

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	1.46e-16	53	567	16	500	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A401ETL2	1.22e-31	45	535	37	586	Exo-beta-1,6-galactobiohydrolase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=bl1,6Gal PE=1 SV=1
Q76FP5	4.11e-26	45	561	24	471	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
E8MGH9	2.81e-07	706	1221	1365	1871	Beta-L-arabinobiosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007148	0.989468	0.000985	0.001431	0.000497	0.000441

TMHMM  Annotations     

start	end
13	35