CAZyme Information: MGYG000000287_02692

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_02692
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
756	MGYG000000287_39|CGC1	83877.88	4.6674

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 5693; End: 7963 Strand: +

Full Sequence      

MKKEDIRQLIAQMTLEEKAGMCSGADFWQLKGVERLGIPSVKVTDGPHGLRMQSEQADHL
GINESIEAVCFPTGCAAASSFDRSLLKRIGEAIGRECQAKGVSTILGPAMNIKRSPLCGR
NFEYYSEDPLVAVEMAAAFTQGVQSQNVGTSMKHFLANNQEKRRMTNSSQVDERTLREIY
LAAFEGAVKQAKPWTIMNSYNRINGTYVGERREYLTDILRDEWGFEGYVMSDWGAVNDRV
EALKAGVDLEMPSSGGINDALIAEAVRDGSLDEAVVDLACERILHIIFRFTENQQQDVAF
EYEKDHELAAEAEGECIVLLKNEDEILPLTKDTKVAFIGKYAETPRYQGGGSSHINSWKV
ESAVEAVKGIAEVTFAKGFEDDVDEVNEDLQNEAVRMAEEAQAAVIFVGLPDNFESEGYD
RKHLNLPNCQNALIENICKGQKNTIVVLHNGSPVAMPWKNQVKGIVEAYLGGQAVGKAVV
NVLYGNVNPSGRLAETFPLHLEDTPCYLTYGKGVDEAVYSEGVFVGYRYYTSKKQEVMYP
FGYGLSYTTFTYSNLKTDKTKMADSEVLTVSVDVENIGNRTGKEVVQIYVAPGETETARP
VKELKAFEKLELAPGEKKTVSFELDGRAFAYWNTEIHDWHVESSVYEIQVGKNADEVLLH
TQIQVEGTRKIEKNYTLNTCMGELMRDEKAKAVLGQMMSKNQQAADMAKVNQDTSGAVNA
QMMAAMMNDMPLRQLLSFVPGMTREMLEQLLAAANQ

Enzyme Prediction     

EC	3.2.1.21	3.2.1.37	3.2.1.23	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	32	252	7.5e-71	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	3.00e-92	6	657	38	757	beta-glucosidase BglX.
COG1472	BglX	3.81e-72	26	380	48	396	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.40e-69	317	527	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	8.20e-68	7	625	54	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	6.42e-37	35	284	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT30267.1	0.0	1	756	1	763
QHQ63232.1	0.0	4	741	4	739
QUI21624.1	8.39e-310	6	755	2	754
QNO18561.1	3.56e-305	5	741	2	741
QUC66582.1	4.22e-304	5	756	2	754

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	8.68e-273	5	755	4	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.50e-192	10	670	9	668	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.95e-137	4	672	2	720	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.62e-136	4	672	2	720	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	6.98e-132	1	666	1	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	6.73e-272	5	755	4	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	4.01e-188	10	672	9	679	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	4.01e-188	10	672	9	679	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q5BB53	7.81e-133	1	669	1	834	Probable beta-glucosidase I OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglI PE=2 SV=2
B0Y3M6	4.16e-132	5	669	5	833	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000287_02692.