CAZyme Information: MGYG000000287_02657

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_02657
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
844	MGYG000000287_38|CGC1	97162.28	4.6949

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 3284; End: 5818 Strand: -

Full Sequence      

MHITKLNKSWVLHEAPLSWDRQYLADINKINEGWYKCDLPVDVRMPLIDAGVIKEPLEGD
NSYESKWMEERSWWFQKHFSSADIGMENEVIELVLEGLDTNSDIFLNDQYIGSHQNVHYP
FICEIKRFLVTGDNKLSIRLTSGLENISIKDLAVIDCAVTAESDFNDSDRGDHRRTMVRR
PQYNIGWDWGPRLVSVGITGQAYVRSYNKIAIREVGIETKEIKKDGDGKLALLNVMVNAE
NLNIVDTVDCDLEIVIRKDGKIAACKTIPDILLTSGTNYLNQELEIQEAELWWPAGYGEQ
PLYQVEITARCADTNESWPVFNYGIRKISIDMPVLEDGTRNFKFIVNGQEIFCKGANWIP
NDFIYARVTAEKYRTLLEEAVEANFNMIRIWGGGLYERELFYDLCDEKGILVWQDFMLAC
GAYPEQQAWFENEIRSEYAYQAKRLRTHSCIALFCGTNENHWIFTNPEFLDRWGIKPSYQ
NQYGLWIPNVLSKEVVWMNCPYIPYWNSSPYGGKNANDLECGDAHLWSHGFVSNDIREAL
DLKSYDAIKTKFVSEYGVLGPCCLESIKEYLGDGDLDRSGKLWKSHTNVTMKDTLEKAIV
QNYLPENHELTESEFILYGGLVQGDVYEYSLESFRFQEDCGGALFWMYNDAWGEVGWTVI
DYYLRRKISYYGVKRAFAQKKFIIRQADDCILIRGINDTKEKLRCKVKFGYVSFDGKISD
TREMVFEVPAGARMQVLKEKIGDYDLECGSYMLYVYDDGIDHAMLYTCPNSRLKYAKSPV
EVMEEEVVGNDKKLVLRAGGYVCGVYIAGNYKCSDNYFNMLPGEERTIIVKDAGNTELEI
KSIR

Enzyme Prediction     

No EC number prediction in MGYG000000287_02657.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	5	733	1.8e-77	0.6808510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.55e-51	3	681	12	633	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	7.41e-04	814	831	40	57	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam00703	Glyco_hydro_2	0.004	210	308	1	88	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	0.008	88	448	125	431	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW77011.1	0.0	5	844	5	838
QBE99829.1	0.0	5	844	5	838
QIB55134.1	0.0	5	844	5	838
QBE97186.1	6.45e-292	1	844	1	836
BBI35730.1	1.24e-227	6	830	5	824

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N6U_A	1.99e-122	34	842	43	821	Crystalstructure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_B Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_C Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12],5N6U_D Crystal structure of Beta-D-Mannosidase from Dictyoglomus thermophilum. [Dictyoglomus thermophilum H-6-12]
2VJX_A	3.90e-95	32	844	23	835	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	4.06e-95	32	844	25	837	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	4.14e-95	32	844	25	837	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	1.07e-94	32	844	23	835	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I2C092	9.87e-76	40	678	32	658	Beta-mannosidase B OS=Thermothelomyces thermophilus OX=78579 GN=man9 PE=1 SV=1
A1D911	1.49e-74	12	675	4	651	Beta-mannosidase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=mndB PE=3 SV=1
Q4WAH4	5.33e-74	12	675	4	651	Beta-mannosidase B OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=mndB PE=3 SV=1
B0YBU9	1.01e-73	12	675	4	651	Beta-mannosidase B OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=mndB PE=3 SV=1
Q2TXB7	1.88e-73	14	675	6	651	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000287_02657.