CAZyme Information: MGYG000000287_01702

Basic Information

• Species: Robinsoniella sp900539655
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Robinsoniella; Robinsoniella sp900539655
• CAZyme ID: MGYG000000287_01702
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1523	MGYG000000287_17|CGC1	169871.94	4.2906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000287	7249439	MAG	Sweden	Europe

• Gene Location: Start: 37044; End: 41615 Strand: -

Full Sequence      

MKKKAANMKIIFLFSMMLLLTVVLPYFTGFTALAAEKEEIIIDNSDTEFIQKSGAWKLSA
GREGKYRSNYSVGSLGSGESTWFQWNMKAPAAGEYSVSFWIPNSESGVHDINSKAVYTVR
HDNEVLDTKTTDQRGIGGHWNTIGSYTFEKGQIYSVRVCADGAGENVNTLADAVRFQYEV
PDDQVQKITVDNTQAAAKGEWTVSKYRPGYFGENYLTIGPGNTQASVTFTPKLTKSGKYA
VYTQMPEGNGDLASEVPYLIKHKNGETSEYVNQQGKNGTWQLVGMYNFEAGMTSSVTIKG
AVSGYTIADAVLFELLDTEVDSKSVIATAKWETQSLDTAIGSDYILTESTDMLMDIVQVK
REGYYNIRYHMPEKGISRSDDAVLSVSGKEFKINSSEMNAGYNLIGKVYISKNGLIDVSL
KNNAQSGLLVFDALLLEYTGYNAVYEDFDMSDSLNTWGTKGNCSVEDGYLKITDGEAQLE
PEGCLNVIIHTVIKPYEIKSGAKFGLILSGSNNTYLKLYLDTNTNKLVLYDEQSDKLLKE
SDKTLPYEENKEIQIQTVFEYPELSVFISGEEYLKTEYSRSGSVGFFADNSSLDVDFVGA
ITSQEVKGGSGEYAIQLDNPKQTIWGLGIEVQSDSIGSGNNGLPESQLRSVPYGLIQSER
ERLYKDMMSGFRYVRFPGGLYYRGVDEEGKHLQERWDTQNEELAEMIEMSGVEGIDFEFW
SPTPYFKASGSYIHGNTDDTDGLRCFSRNFANDPVYKGDKQRFLNDFADTIVEDLKMLEA
NGIPVVQWGLQNEADHWVRDYSHCKYTNEEYYQTMKAVVPKIRAAFPDIHIHADSWNGQY
SSTVQELKKDPELVNEIDGWTFHRIGYDSNDQINNADYYNSGKVRDDIPVYNNEFEYFSA
TSDWKCINTAQSIMNWMTFENSPTWHWLHVLKPFGNSEASGFSLGSFRPLDFDESKESVP
EGFEGVEAGHWEYNYQNWNAIRGFLKYMPWNSIRYEVSEDRVREDNRIMSYQTQEGKQII
VLTNRSKTDLFTFNISTGLDDTWRGYRYTPQSENEITLGTLSGETISPTLPPYSIEFWVQ
DGEHVVPERGVELNTAEAELDVDETLALNVTIKEVNPAIPGLTWSSSDNEVVSVDKSGLA
KALSAGQAIITVTRKDGGFSATCQVTVTDEAPEPGEKTDMTSLKLAITMAEKLEQEYEEN
KYYTEESWNIVQSALNSARDLVDNTEAEQEQADSAFIDLITACNLLESSTHKVGLKATVR
GVEAILADEDGLSEYTPESVSNVRISLSKAQSVLNNTGADQGAVNQASTELMTAVTNLLV
IKSDTRLDILIQIAEQIMEKSELYTLSCIENLKIALEDAKEMDQNINSEEEINKAYNNLA
NAMSSMIRRANKEELKNAIDKSDEILASAGNYVESTITGLEAVTLKAREVYDDSEAGSDI
TGEVLKKLIAEILKARLLGDIDLNGTVDTRDVAELLKYTAEAKILTQEQIEAGNVNGDNI
CDSSDGAIILQYAVEKINSIRGE

Enzyme Prediction     

No EC number prediction in MGYG000000287_01702.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	690	1055	1.8e-18	0.709832134292566

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14488	CBM6-CBM35-CBM36_like_2	9.85e-31	186	311	1	129	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
cd14488	CBM6-CBM35-CBM36_like_2	2.49e-19	40	176	3	131	uncharacterized members of the carbohydrate binding module 6 (CBM6) and CBM35_like superfamily. Carbohydrate binding module family 6 (CBM6, family 6 CBM), also known as cellulose binding domain family VI (CBD VI), and related CBMs (CBM35 and CBM36). These are non-catalytic carbohydrate binding domains found in a range of enzymes that display activities against a diverse range of carbohydrate targets, including mannan, xylan, beta-glucans, cellulose, agarose, and arabinans. These domains facilitate the strong binding of the appended catalytic modules to their dedicated, insoluble substrates. Many of these CBMs are associated with glycoside hydrolase (GH) domains. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. CBM36s are calcium-dependent xylan binding domains. CBM35s display conserved specificity through extensive sequence similarity, but divergent function through their appended catalytic modules.
COG5492	YjdB	1.34e-11	1073	1169	166	263	Uncharacterized conserved protein YjdB, contains Ig-like domain [General function prediction only].
pfam02368	Big_2	2.13e-10	1090	1165	2	77	Bacterial Ig-like domain (group 2). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial and phage surface proteins such as intimins.
cd14256	Dockerin_I	2.05e-09	1458	1512	1	55	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW09945.1	5.33e-133	610	1080	41	488
ALN90629.1	7.58e-131	612	1080	30	480
QWB27211.1	1.62e-121	607	1078	39	495
AQQ08375.1	1.72e-117	610	1080	1471	1918
AQQ08380.1	1.54e-116	610	1080	480	927

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6F2P_A	5.82e-17	142	311	861	1034	Structureof Paenibacillus xanthan lyase to 2.6 A resolution [Paenibacillus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9AQS0	1.78e-12	182	313	788	926	Xanthan lyase OS=Bacillus sp. (strain GL1) OX=84635 GN=xly PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.007371	0.991174	0.000567	0.000407	0.000235	0.000218

TMHMM  Annotations     

start	end
12	34