CAZyme Information: MGYG000000284_03772

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_03772
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
992	MGYG000000284_76|CGC2	112157.48	6.5803

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 22433; End: 25411 Strand: +

Full Sequence      

MNKTFLLSACLFMGQGLLAADTSGTLSPESAYLIPCEISGVNNSSILLSGTWQFRYDDKG
KWSNVQVPGELAMQGYAIKHDTPYLYRKSFTLPADYKGKRTILRFDGVYSHARLWVNGKE
VREHHGGFTRWETDVTGFVHPGKKNEIQLEITDRIDDISYASGYGHHPIGGILRDVTVFA
LPETCLYDFSAETHLDTLYKDAVLKVSYQGKTSGNAEVAYTLTDPSGRNVSLPQATFPLK
ENGNSNELSVRNPLKWDAEHPNLYTLAVSIREGGKELTRFSKRIGFRDVKIVKDRMLVNG
LPVKLRGACRHDIHPTLGRTTTAELDSLDAIRFKQSNMNFVRTSHYPPSEKFLEYCDRFG
IYVECETAVCFVDTYRQKNYAPGKTQDSAEFTPRYLSQCREMVKSFRSHPSILFWSIGNE
SVYGKNFQLCWDWVKATDTTRPVIFSYPGSVGEKKPIYDILSMHYQDVDGNLNQWGRATR
NFQGHGIPALFDEWAHPACYTYKTLQDDPNIREFWGISLDKMWSGLFDAPGGLGGAIWGY
IDETFMLPEPKKGTSFWKEFARTAKPEDYQGNCVGYGEWGIVDVWRREKPEFWSTKKAYS
PIRLLTEQVSDFTTGERLILPVYNRFDHTNLNEVKVRYTYNNGVEKEAVSPVVEPHQKGL
LVIPSEDWKAGSDLLVSFLDADNELIDAFLVTLGQPVVALPQPTHKGALQLEETSDRFVV
KGNGFEIPFSKETGLIDNATVDGKTLIEKGPFLNLDINLNHLTGAEVRKSATKFITSEAD
WKKENITCEKRGSNILVSLTGSYRNVRTDIRILISSEGKMEINYLTDGQPNGFLRETGLS
FYLPETIDQLSWKRKGHWSYYPAGEFAGNEGSTSLYNPNKVAYGARPDQPWADDTHDYYY
WADAGANCDRPLTRKAKGMKENIYFYTLSPATGDGLSVISPDASVACRSNKRADGQLILY
VNNRWDYPEIAWGNYCKTLEATPCYGKIEIIF

Enzyme Prediction     

No EC number prediction in MGYG000000284_03772.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	43	862	4.2e-130	0.9521276595744681

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10340	ebgA	8.29e-88	47	856	43	872	cryptic beta-D-galactosidase subunit alpha; Reviewed
COG3250	LacZ	1.57e-70	48	472	15	453	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK09525	lacZ	1.56e-55	47	469	54	508	beta-galactosidase.
PRK10150	PRK10150	5.38e-48	48	445	15	447	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	5.51e-36	289	602	1	300	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT50213.1	0.0	3	992	5	994
QKH86406.1	0.0	11	990	10	998
QCQ30210.1	0.0	11	990	10	998
AUI47953.1	0.0	11	990	10	998
QCQ34661.1	0.0	12	990	16	998

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3DEC_A	1.32e-66	60	861	74	874	ChainA, Beta-galactosidase [Bacteroides thetaiotaomicron VPI-5482]
3BGA_A	1.44e-66	48	861	51	878	Crystalstructure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482],3BGA_B Crystal structure of beta-galactosidase from Bacteroides thetaiotaomicron VPI-5482 [Bacteroides thetaiotaomicron VPI-5482]
6S6Z_A	1.25e-63	46	867	39	869	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	1.26e-63	46	867	40	870	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
3I3B_A	3.48e-44	28	546	70	576	ChainA, Beta-galactosidase [Escherichia coli K-12],3I3B_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3B_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3B_D Chain D, Beta-galactosidase [Escherichia coli K-12],3I3D_A Chain A, Beta-galactosidase [Escherichia coli K-12],3I3D_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3D_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3D_D Chain D, Beta-galactosidase [Escherichia coli K-12],3I3E_A Chain A, Beta-galactosidase [Escherichia coli K-12],3I3E_B Chain B, Beta-galactosidase [Escherichia coli K-12],3I3E_C Chain C, Beta-galactosidase [Escherichia coli K-12],3I3E_D Chain D, Beta-galactosidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	6.89e-63	46	867	40	870	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	2.57e-59	48	897	61	952	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
Q8D4H3	2.74e-51	40	862	42	914	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2
P81650	8.78e-51	37	747	77	788	Beta-galactosidase OS=Pseudoalteromonas haloplanktis OX=228 GN=lacZ PE=1 SV=2
Q6LL68	2.66e-50	46	862	81	912	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000228	0.999067	0.000211	0.000165	0.000153	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_03772.