CAZyme Information: MGYG000000284_02700

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_02700
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000000284_39|CGC1	76466.11	4.7436

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 42589; End: 44604 Strand: -

Full Sequence      

MKKSILFLSLICGACTAPQDTLVEQVDRLSTSTQNDYYVSNRAPLQPQQFIKLPAGTIQP
EGWLKQQLELQKNGLNGHLGEISAWLQKKDNAWLKTGGQWGWEEVPYWLRGYANLAYIVQ
DNQMLNEAKFWIESILKSQREDGNFGPMHLNDGKQDFWPNMIVLWIMQSYYEYSNDERII
DFMTKYCNYLLTVPDEDFLYSYWENSRGGDNLWSVVWLYNHTGYKNLLTLGEKIHKNTAD
WTKSTQLPNWHNVNVAQCFREPATYYLFSGDSSMLSASYNVQSLVRRAFGQVPGGMFGAD
ENARIGFFDPRQGTETCGFVEQMASDEIMLQISGDPYWAENCEDVAFNSYPAALMPDYKA
LRYITSPNHIVSDSKNHHPGIDNSGPFLSMNPFSSRCCQHNHGFGWPYYTENLIYATSDN
GMAAVLYNACQAKVKVGGGTEVTIKEQTNYPFEETVRFTLTTPENVTFPLYLRIPSWCKD
ASVAVNGQKLGVDLIAGKYVKITREWSDADEIVLTVPMTFNYRQWQVNKNSVSVDYGPLT
LSLKIDEDYQQKDSRETAIGDSKWQEGADASAWPTYEIYPASPWNYALQINAPISVLRKE
WPFDNNPFTLTNVPLIFKTQGRLIPEWKIDECGLCGVLPYEDAKKSDTLDEITLVPMGAA
RLRIASFPTTE

Enzyme Prediction     

No EC number prediction in MGYG000000284_02700.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	314	540	1.9e-32	0.4217557251908397

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.30e-109	98	542	46	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	2.02e-23	101	518	57	476	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKW18167.1	2.35e-173	6	671	19	671
AWL89945.1	1.13e-171	32	669	38	666
QXQ95199.1	2.18e-171	32	669	38	666
ADJ45365.1	2.45e-171	33	671	39	663
AFO77076.1	2.45e-171	33	671	39	663

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	1.45e-18	104	592	78	627	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5MQO_A	7.83e-17	315	544	381	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QK0_A	9.56e-17	104	592	78	627	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000035	1.000022	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_02700.