CAZyme Information: MGYG000000284_01395

Basic Information

• Species: Parabacteroides sp900540715
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900540715
• CAZyme ID: MGYG000000284_01395
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000000284_15|CGC1	65616.2	6.3777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000284	5935659	MAG	Sweden	Europe

• Gene Location: Start: 3610; End: 5370 Strand: +

Full Sequence      

MKKILILFTLFCTLSATARQRDSRIREYLSPTRIVWQQHSEQIQDADNLLLPGNGQAGLV
DRTICKLKSTKGKHPAILFDFGKELQGGIQLVTGGFPDHKPISVRIRLGESVSEAMCEID
GKNGASNDHAMRDCIVSLPWMGVMEIGNSGFRFARIDLIDDSTELHLKEVRAISTYRDIP
YKGSFRSSDERLNKIWQTGAYPVHLNMQEYLWDGIKRDRLVWLGDMHPEVMTINSVFGYN
EVVPKSLDLIREATPLPDWMNGISAYSIWWLLIQRDWYYYQGDKTYLKEQQPYLSGLLRQ
LLSKVDASGHEKLDGWRFLDWPSSENPEAINAGLQALVLQAMKAGGELCTVLGDETLATE
CLETAKRMIKVAPQVTKTLLKSKIAPDAPGSKQAAALLALAGLMKPEEADKKYLSVNGAQ
GFSTFYGYYMLRAMATAGNYQGAIDVIRQYWGAMIDLGATTFWEDFNMAWLPDAAAIDEL
VPEGKKDIHGDYGDYCYKGFRHSLCHGWASGPTAWLSEYVLGVQVVEPGCRVVRITPYLG
DLDWVEGTFPTPEGIITIRHEKGTDGKIKSDIKAPTGVRVILENSK

Enzyme Prediction     

No EC number prediction in MGYG000000284_01395.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	76	581	6.3e-102	0.9781746031746031

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	4.37e-15	183	520	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	1.79e-06	522	579	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT48045.1	0.0	1	581	1	582
QUR50485.1	0.0	2	580	3	580
ABR43079.1	0.0	2	583	3	583
QRO16730.1	0.0	2	583	3	583
QUT54421.1	0.0	2	583	3	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	3.99e-47	70	567	187	689	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
4XHC_A	2.65e-20	76	521	94	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000349	0.998926	0.000242	0.000167	0.000148	0.000134

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000284_01395.