CAZyme Information: MGYG000000278_03659

Basic Information

• Species: UBA3402 sp003478355
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; UBA3402; UBA3402 sp003478355
• CAZyme ID: MGYG000000278_03659
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
470	MGYG000000278_45|CGC1	53481.34	5.793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000278	4338723	Isolate	China	Asia

• Gene Location: Start: 28619; End: 30031 Strand: -

Full Sequence      

MKVQNGTCSDVRVAYIGGGSHGWAWTFFKDLAREEKMSGIIDLYDIDRPMAEQNAEIGTR
LFKRSDVKGNWKFEVSGSLKELLEKKPEFVIISILPGTFDHMASDVHLPEKYGIYQSVGD
TAGPGGLVRALRTIPMFVEIAEAIKEYCPETLVINYTNPMTLCVKTLYRVFPQIKAFGCC
HEVFGTQKILRDMYQLATGETDVERDEVIVNVQGINHFTWFDRASCRGVDLFPIYRKFID
EHFEDGYHDPDRNWMNGTFNCAHRVKMDLFNKYGNIAAAGDRHLAEFLPGDVYLRDPEQV
HQWKFALTPVSWRKERQAEKIEEAKRLASGEEELKLEATGEEGILLMKALCGLNRMVSNV
NIPNTAGQIPNLPRTAVVETNAVFYKGTIQPIFAGEMKPVIRDLVMPHVENHERILEAAM
KPNFGLAYEAFMNDPLVHGRISREDGEKLLKEMIQNTLDVLPEGWKKEIQ

Enzyme Prediction     

No EC number prediction in MGYG000000278_03659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	13	192	1.2e-50	0.9776536312849162

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	4.19e-144	11	453	1	419	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	5.61e-95	11	463	4	438	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	7.25e-55	11	463	2	429	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	8.04e-52	12	192	1	179	Family 4 glycosyl hydrolase.
cd05296	GH4_P_beta_glucosidase	3.10e-43	12	455	2	413	Glycoside Hydrolases Family 4; Phospho-beta-glucosidase. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by the GH4 glycoside hydrolases such as the phospho-beta-glucosidases. Other organisms (such as archaea and Thermotoga maritima ) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. The 6-phospho-beta-glucosidase from Thermotoga maritima hydrolylzes cellobiose 6-phosphate (6P) into glucose-6P and glucose, in an NAD+ and Mn2+ dependent fashion. The Escherichia coli 6-phospho-beta-glucosidase (also called celF) hydrolyzes a variety of phospho-beta-glucosides including cellobiose-6P, salicin-6P, arbutin-6P, and gentobiose-6P. Phospho-beta-glucosidases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIX89596.1	2.92e-219	1	466	1	466
ANU44839.1	4.15e-219	1	466	1	466
QQR00399.1	4.15e-219	1	466	1	466
QRP39116.1	5.88e-219	1	466	1	466
ASN96107.1	5.88e-219	1	466	1	466

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	3.64e-146	11	455	6	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	2.28e-25	11	466	5	439	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	2.16e-23	11	466	8	442	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	7.94e-19	11	454	4	465	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
6VC6_A	2.07e-11	12	255	5	242	2.1Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_B 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_C 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis],6VC6_D 2.1 Angstrom Resolution Crystal Structure of 6-phospho-alpha-glucosidase from Gut Microorganisms in Complex with NAD and Mn2+ [Merdibacter massiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A9KTB9	2.46e-202	1	465	1	464	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
I3VRU1	4.43e-188	1	466	1	462	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	5.32e-169	1	465	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
P39130	8.85e-151	7	455	6	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
O34645	2.54e-43	12	463	3	430	Alpha-galactosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=melA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000278_03659.