CAZyme Information: MGYG000000265_03672

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_03672
• CAZy Family: GH85
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1021	MGYG000000265_25|CGC1	113333.25	4.6283

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 26262; End: 29327 Strand: -

Full Sequence      

MKRITLACMAAVCCLSWGTPVMAEGDIPPSASTELFDFTPFNDREMLELFLTAQENGRKY
PTEAEFEAAGFNLIDLEFARSHVRPRAILKDKSKNLYPNIYENRNLWMNIPMGVGKAIGG
YPSSTFSDDTYSMWNYTNLFGSWNHGLFQAPGSWVDAAHKNGTDIFSGIKFFESWTPGSE
SAKYREMITAKNPDGSFKYAEAFINCLMFFGTDGINYNWEDTGYADADVMAFHKELYKIA
EREGFKNFHIGIYTSNSTLSQRYVDALYGTKETGKTADLMLNYAGGDFSYGIGSSVDIAE
ANYGNADGVYTGVWIVSMDRRWSALNENESAKKAGVCLWGEHGQSRFMSYNVGATSMEFQ
SNYQKLLERTFSGGNRNPANLLPVSNTGNNWEQDGDKEPLESFCGLATFIPERTAIQGDL
PFNTFFSLGNGERYNYKGKKTFASWYNIGAQDVVPTYRWLVYDAGTTTVSTKIQPSFTHE
DAYIGGSALRLEGSSTDNGTDIVLYRSKLKVSGTDPVVKVALKSGATGTEPSRLYVILKK
ENNDQWFEYAVGETNGPTWEEKQIALAGFSSNDVIEYIGFRVKGAYAGNYNMLVGKLELS
DSRIATPANIKSNSLVVEVKEETTKSLSLKLNWAVDPTGLNFSRANWGLLYNDEANIDHF
EIMYKNGENGKISEIARTTGWSGFAGNIVFEGDSDEPYVGVRSASVDFKTYSPIQWVKVE
RSTSPNLPAPKDNTYCESVVNPAAEGVDIAREQRYVESFTTTGADQNLDYHASAPQPDGT
QYVNATDHVLKVKQGQTITLSFKAYDTSTLSKVDGLRFCFAKGYMDLDKSDSFEPDGDEL
LFDLGTVRKGTPEFETVGYTKEFTIPADAAVGKSRLRVVFSDAWFAHPGPCGQTAKGFSI
DFGVEITGDNPQRPVAPDLHDQGEADEPDRVRDEDPTTPPSGVENIKEGYAGFSKCWMDP
AENVIFFQDVERAWIYTTTGQLVKYVIGNPESLNVAELTSGVYIVKMEYNNVIRSQKLLK
Q

Enzyme Prediction     

No EC number prediction in MGYG000000265_03672.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH85	124	434	1.8e-40	0.9492063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4724	COG4724	9.28e-30	120	601	90	551	Endo-beta-N-acetylglucosaminidase D [Carbohydrate transport and metabolism].
cd06547	GH85_ENGase	1.99e-22	119	465	8	339	Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins. The beta-1,4-glycosyl bond located between two N-acetylglucosamine residues is hydrolyzed such that N-acetylglucosamine 1 remains with the protein and N-acetylglucosamine 2 forms the reducing end of the released glycan. ENGase is a key enzyme in the processing of free oligosaccharides in the cytosol of eukaryotes. Oligosaccharides formed in the lumen of the endoplasmic reticulum are transported into the cytosol where they are catabolized by cytosolic ENGases and other enzymes, possibly to maximize the reutilization of the component sugars. ENGases have an eight-stranded alpha/beta barrel topology and are classified as a family 85 glycosyl hydrolase (GH85) domain. The GH85 ENGases are sequence-similar to the family 18 glycosyl hydrolases, also known as GH18 chitinases. An ENGase-like protein is also found in bacteria and is included in this alignment model.
pfam03644	Glyco_hydro_85	9.45e-10	122	431	1	291	Glycosyl hydrolase family 85. Family of endo-beta-N-acetylglucosaminidases. These enzymes work on a broad spectrum of substrates.
TIGR04183	Por_Secre_tail	1.02e-07	975	1021	25	72	Por secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber average twenty or more copies of a C-terminal domain, represented by this model, associated with sorting to the outer membrane and covalent modification.
pfam18962	Por_Secre_tail	4.19e-05	975	1018	23	70	Secretion system C-terminal sorting domain. Species that include Porphyromonas gingivalis, Fibrobacter succinogenes, Flavobacterium johnsoniae, Cytophaga hutchinsonii, Gramella forsetii, Prevotella intermedia, and Salinibacter ruber have on average twenty or more copies of this C-terminal domain, associated with sorting to the outer membrane and covalent modification. This domain targets proteins to type IX secretion systems and is secreted then cleaved off by a C-terminal signal peptidease. Based on similarity to other families it is likely that this domain adopts an immunoglobulin like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74553.1	0.0	1	1021	1	1020
BCI64641.1	0.0	2	1020	3	1006
AGB28382.1	0.0	20	1019	191	1188
QFQ13761.1	0.0	1	1018	1	989
QUB47476.1	0.0	19	1018	21	1003

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VTF_A	4.25e-23	114	671	66	575	X-raycrystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae],2VTF_B X-ray crystal structure of the Endo-beta-N-acetylglucosaminidase from Arthrobacter protophormiae E173Q mutant reveals a TIM barrel catalytic domain and two ancillary domains [Glutamicibacter protophormiae]
3FHA_A	9.65e-23	75	671	26	570	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_C Chain C, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHA_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]
3FHQ_A	1.28e-22	114	671	61	570	ChainA, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_B Chain B, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_D Chain D, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae],3FHQ_F Chain F, Endo-beta-N-acetylglucosaminidase [Glutamicibacter protophormiae]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000263	0.998893	0.000323	0.000182	0.000163	0.000142

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_03672.