CAZyme Information: MGYG000000265_02824

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_02824
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
975	MGYG000000265_11|CGC2	111338.87	6.7993

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 87978; End: 90905 Strand: +

Full Sequence      

MEKKYLLLACVTLFSQLHIYSKEQQSINLGDTPWKFSKVIRQETNLAKDASILYGLQKVS
EINDDDIHTEWRADYSSEKHLFIDLHEKKQLKNFKLIFKGDQTRFATVKMEASLNNEDWY
PMAEGTVKRACDLHKEGDISNVNNTVGYFEKVTYTYLSIPVSASYRYIRLTILSCQSEKN
EELPKRISELAIYPVENNYSDQEIAGLAFKDDQWESVGIPHCFNERDTYLNASTGERCWR
GEAWYRKKIGFSKKDRDKEIFLEFQGINFAAIVFINGQAIPGNTQVQHPGIVTHVGSALP
FVVNITKYIKWNTENQIAIKVSNAKNTFFTWPEFGTNEGFGQAMGGIVCPIYMHKKHKIH
IPFNRYSPLKKWGTYLGTVSATPQKATIRFQVNVDNTTDQEQDIELRTYLQDQQGHTVLS
FSDKQKVSARTTQLFDHTESIQNPHLWYPIGCSGTPYLYTVLNKVYVNGKLADSQSEPFG
IREITWDENYCYVNGEKCILRGFGSRNIYPGLGAAIPAALQWQDIALIAQCGGNTLRVGH
QPPFTEALKACDAYGVLLITNSGDGEWSLKNEPAKTYKREYDREMLVAFRNHPSVVIWES
NNGLAYDGDKYLPSHTLSEVKAWDYIQPRLVLNRDGYPPEWDEKEPIVIGYTNRYEKVKG
RPSLNTEVYGANWSGLPSWCIARFDYNNEKEFSMDYIRNYLDNLDNQACGWIDWMLVETY
GEGYTIYLNGMKNQKSLGSCAMDGNRFPKLKYRIYQKALWVPYSQQPGVALQSHWNYSGI
QNIDAWSNCLYVELFINKKSYGIVEPDQRTRQCTWRDIQWEPGTVEAVGLDTNKHPVCSE
KIESSDKPYAIEVTIEKPAAKPTGEEFILKANASDAFIVTAKVVDKDGHWCPWADNLLKF
EVEGEGIYKGSYNFYVTEGKDLSYHAPGDTELQAEGGLMRVAVRTTFKPGKIKVKVSSDG
LISGESIIKSKKIKH

Enzyme Prediction     

No EC number prediction in MGYG000000265_02824.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	208	843	2e-65	0.6781914893617021

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.95e-26	195	598	25	412	beta-D-glucuronidase; Provisional
COG3250	LacZ	5.64e-26	219	602	47	405	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	1.03e-18	869	965	10	101	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam00703	Glyco_hydro_2	3.35e-15	374	482	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10340	ebgA	1.94e-14	257	606	125	452	cryptic beta-D-galactosidase subunit alpha; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT74086.1	0.0	3	974	4	974
AXF04603.1	1.10e-142	209	964	67	848
AUT74975.1	2.87e-142	209	964	67	848
BCF94458.1	1.66e-141	209	964	47	828
AUT65738.1	1.99e-141	209	964	67	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	2.39e-75	207	970	57	804	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	2.12e-53	207	968	47	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.35e-47	196	968	21	805	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	7.75e-47	208	968	27	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
6ED1_A	8.41e-45	193	805	35	650	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei],6ED1_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Phocaeicola dorei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	1.17e-74	207	970	48	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	2.63e-60	203	961	60	839	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KPJ7	2.16e-38	195	920	63	793	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	4.30e-38	209	973	27	741	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	2.33e-29	211	905	72	759	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.010180	0.985403	0.003701	0.000217	0.000221	0.000235

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_02824.