CAZyme Information: MGYG000000265_00345

Basic Information

• Species: Bacteroides nordii
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides nordii
• CAZyme ID: MGYG000000265_00345
• CAZy Family: GH16
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
509	MGYG000000265_1|CGC7	56790.59	6.6403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000265	5489209	Isolate	China	Asia

• Gene Location: Start: 388832; End: 390361 Strand: -

Full Sequence      

MNVDKRKLWTAASVLILSGPLTAQQQPNIILFLVDDMGWQDTSVPFWTETTELNQIYHTP
NMERLSQMGVKFTHAYANSISSPSRVSLFTGANAARHRVTNWTLKKDVSTDRKNDLLAFG
DWNYNGLCPQEGIPYTFYAKCLPELLRENGYTTMMVGKAHFGSLDTPAADPLTIGFDYNI
AGHAAGAMGSYLGEEGYGANGNPEWAKIWAVPDLEKYHGTDTFLTEALTLEAKGLMDKAL
AKEKPFFLYMSHYAVHAPFATDKRFYDRYIAKGLSHKEAQYAGLVEGMDKSLGDLMDYLE
VKGIAQNTVIIFMSDNGGYTIGRTNKNYPLSEGKGSLKEGGIREPMIVCWPGVTQPATVN
VTPVIIEDFFPSILELAGMKGRIHTPQIIDGRSFVAQLKGKQGDQKRPLYFHYPNNWGER
YETTGAPQSAVIEGDWKLIYYYESQTSALFNLKEDISEQQNLIGEKAYQKIALKLAKDLT
RHLKKTNATMPVVKVTGDFVKYPDGSGVE

Enzyme Prediction     

No EC number prediction in MGYG000000265_00345.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16144	ARS_like	1.10e-167	27	482	1	421	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	4.26e-85	26	463	1	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16146	ARS_like	1.32e-83	27	481	1	403	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16031	G6S_like	2.15e-82	25	479	1	426	unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.
cd16145	ARS_like	2.85e-78	27	462	1	410	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89376.1	2.78e-276	5	509	2	503
ALJ59588.1	3.21e-275	5	509	2	503
EAR02039.1	8.71e-172	24	503	26	508
AKJ65363.1	1.20e-60	25	473	25	436
BAX82390.1	1.02e-39	13	462	18	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6USS_A	3.84e-175	26	504	33	515	ChainA, Sulfatase [Bacteroides fragilis CAG:558],6USS_B Chain B, Sulfatase [Bacteroides fragilis CAG:558]
6UST_A	2.58e-60	26	462	4	434	ChainA, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_B Chain B, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_C Chain C, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi],6UST_D Chain D, N-acetylgalactosamine 6-sulfate sulfatase [Hungatella hathewayi]
7STT_A	5.66e-59	21	491	1	441	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]
3ED4_A	1.40e-45	25	466	26	457	Crystalstructure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_B Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_C Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli],3ED4_D Crystal structure of putative arylsulfatase from escherichia coli [Escherichia coli]
6PSM_A	1.49e-45	26	465	24	421	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ9	6.15e-57	23	509	31	549	Sulfatase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22020 PE=3 SV=1
Q571E4	7.10e-39	23	464	24	424	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
Q32KH5	6.06e-37	19	464	22	426	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
Q32KJ6	1.95e-35	23	415	28	390	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
P34059	2.03e-33	19	412	23	385	N-acetylgalactosamine-6-sulfatase OS=Homo sapiens OX=9606 GN=GALNS PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001251	0.997235	0.000786	0.000298	0.000215	0.000188

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000265_00345.