CAZyme Information: MGYG000000264_02481

Basic Information

• Species: Exiguobacterium sp003467445
• Lineage: Bacteria; Firmicutes; Bacilli; Exiguobacterales; Exiguobacteraceae; Exiguobacterium; Exiguobacterium sp003467445
• CAZyme ID: MGYG000000264_02481
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
216	MGYG000000264_10|CGC1	24304.13	10.8279

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000264	2830712	Isolate	China	Asia

• Gene Location: Start: 34241; End: 34891 Strand: +

Full Sequence      

MKNILVCCITCLMIITSSFPFTISVEAATKKENRAIMGTSALKPQQMADYVKTKNPKNVR
LHGTTVEELAKLFIILGAKEGVRGDVAFAQALKETGYFRYGGDVLPKQHNYSGIGTTGKG
VKGHFFRSPHQGVLAQIQHLKAYASKDNLNSTRVDPRFHYVKRGSATTWPALHRKWAMQP
QAITATRFSLFIKRWDRQNSASPKNERTIMTYRGER

Enzyme Prediction     

No EC number prediction in MGYG000000264_02481.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01832	Glucosaminidase	2.68e-10	70	146	1	81	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUE86308.1	1.39e-126	1	180	1	180
QUP86788.1	5.94e-94	13	186	13	187
QPI67327.1	2.41e-93	13	186	13	187
AWG44240.1	8.82e-67	1	181	1	181
QOK29791.1	3.99e-48	32	178	14	159

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O51481	4.05e-29	46	177	48	179	Uncharacterized protein BB_0531 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0531 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000312	0.998996	0.000198	0.000166	0.000163	0.000144

TMHMM  Annotations     

start	end
5	27