CAZyme Information: MGYG000000257_01916

Basic Information

• Species: Collinsella sp900540855
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900540855
• CAZyme ID: MGYG000000257_01916
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
290		33356.16	5.3502

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000257	2328325	Isolate	China	Asia

• Gene Location: Start: 1506; End: 2378 Strand: +

Full Sequence      

MLDEIDPDVVHLHVLLGYYINIEMLFTWLSNHRCQVLWTLHDCWAFTGHCIHFEYVQCEQ
WKSHCGKFSQCPQPDAYPETIRKGMESWSFEKKKSIFTMLPPERMRLIVPSRWLEGLVQQ
SFLSKYDITVQHNQIDKSIFRQIDSCFKKNNGLENKTLILSVASKWTERKGLNDVIHLSQ
VLDLNNYAIVAVGLNKQQIKQAPTSIIALPRTDTVDELVDIYNAADVFFNPTREDNYPTV
NLEAEACGTPVITYDTGGCAETICLEQSKVVESFQQAVLTIKNIFDNCVE

Enzyme Prediction     

No EC number prediction in MGYG000000257_01916.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03825	GT4_WcaC-like	2.33e-73	1	263	46	302	putative colanic acid biosynthesis glycosyl transferase WcaC and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Escherichia coli WcaC has been predicted to function in colanic acid biosynthesis. WcfI in Bacteroides fragilis has been shown to be involved in the capsular polysaccharide biosynthesis.
cd03801	GT4_PimA-like	7.60e-20	6	263	82	306	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	3.77e-18	3	283	80	341	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03798	GT4_WlbH-like	2.01e-15	106	263	153	315	Bordetella parapertussis WlbH and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. Staphylococcus aureus CapJ may be involved in capsule polysaccharide biosynthesis. WlbH in Bordetella parapertussis has been shown to be required for the biosynthesis of a trisaccharide that, when attached to the B. pertussis lipopolysaccharide (LPS) core (band B), generates band A LPS.
PRK10125	PRK10125	1.64e-14	7	261	95	343	colanic acid biosynthesis glycosyltransferase WcaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QOS69951.1	5.19e-114	2	284	67	346
QUC03714.1	6.54e-103	2	278	84	451
AOZ95445.1	8.10e-91	4	278	95	367
CEP78286.1	8.21e-89	4	263	87	340
ADL33100.1	8.59e-89	4	271	100	389

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P71237	5.23e-09	7	271	95	353	Putative colanic acid biosynthesis glycosyl transferase WcaC OS=Escherichia coli (strain K12) OX=83333 GN=wcaC PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000257_01916.