CAZyme Information: MGYG000000251_01871

Basic Information

• Species: Fusicatenibacter saccharivorans
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Fusicatenibacter; Fusicatenibacter saccharivorans
• CAZyme ID: MGYG000000251_01871
• CAZy Family: GH39
• CAZyme Description: HTH-type transcriptional activator RhaS

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
832		96947.64	5.4791

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000251	3784614	Isolate	China	Asia

• Gene Location: Start: 97267; End: 99765 Strand: -

Full Sequence      

MERDNRDEDMMLKGTKQEMPGFRFRLLRPEKKRELWNPDFELLFLLRGSGRVSYEDGEVH
NLPMGSIFAINRFQICDLDLDEDGLALSLCVSAETIDSFHIKLLKCEVKCQSFFYMEDQQ
EKFDLIRRDMARIFLEMYKNNEEQPIYMKSRVTALLEDLLFYFTSGEKVEQGRGGRERIQ
RASDYILQHCREEITLEDLADHLYLSRAYISRSFPQYFGVSFREYVTQVRLAHAVQEMHS
GATLTEIAYHNGFVNETAMIRAFRKYRGMTPSEYRKQMEYTVKQREKKGKEREEAAGDHD
IFQSLLQYAAVTEQEIETINESAVSVTAAVNGRKPRVAGHWKRVINAGYAASVLNREVQD
ELEQLVQELGYELIRVKGILDDDMCVLRRNMWGEIQFCWNYIDEVIDFILSTGAKPLLEF
GHMPLLLAKTDPGRTMRPALSSSPRDLAEWRMLIKNLMEHLRERYGINQMRRWIFNPWIS
GDVITIDGGDEFFETWKASYEEMKRVSPDLVTCLSFGLGPEEHLKAFIETMKEKECVPEI
FAFRSFGTVIYGEEEEKMNLIQNNESVNMIVSRDPDFLRNRGEKVKGLLQKAGLGALPVL
VDECSSNIWQRDLCNDTCYKAAWLFKNLLENEEALQGIAYFSVNDRLDEVFPARETYHGG
FGLFTMNGIPKAVCTALRLLGRMGSRLVKRGDGYFISTEPEKNQSQIYLYNYVHYDMLYR
YRHAVNISRTDRYRVFNMGEIRTFSVKLTGLEPGKYCLRLYKVTKEHGSSYDAWVRMGAP
ERMNRMERAMLCHSADPEYRVWEQETDPEGSLTVQERLEPHETALIEVEQIL

Enzyme Prediction     

No EC number prediction in MGYG000000251_01871.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	339	783	1.7e-75	0.9814385150812065

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01229	Glyco_hydro_39	5.56e-41	324	828	3	487	Glycosyl hydrolases family 39.
COG2207	AraC	1.60e-28	173	278	16	122	AraC-type DNA-binding domain and AraC-containing proteins [Transcription].
smart00342	HTH_ARAC	1.55e-25	193	275	1	84	helix_turn_helix, arabinose operon control protein.
COG4753	YesN	2.80e-22	179	277	374	473	Two-component response regulator, YesN/AraC family, consists of REC and AraC-type DNA-binding domains [Signal transduction mechanisms, Transcription].
pfam12833	HTH_18	1.28e-21	199	277	1	81	Helix-turn-helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ24049.1	3.01e-179	22	826	11	815
AYA77562.1	1.54e-125	36	828	30	828
AIQ21948.1	7.97e-118	22	831	16	844
AIQ37108.1	3.36e-115	36	828	30	824
QBE96237.1	1.54e-111	27	826	4	813

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BFG_A	1.19e-42	326	831	4	483	crystalstructure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_B crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_C crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_D crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_E crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_F crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_G crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus],2BFG_H crystal structure of beta-xylosidase (fam GH39) in complex with dinitrophenyl-beta-xyloside and covalently bound xyloside [Geobacillus stearothermophilus]
2BS9_A	1.61e-42	326	831	4	483	Nativecrystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_B Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_C Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_D Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_E Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_F Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_G Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus],2BS9_H Native crystal structure of a GH39 beta-xylosidase XynB1 from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1W91_A	2.95e-42	325	831	3	483	crystalstructure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_B crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_C crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_D crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_E crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_F crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_G crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct],1W91_H crystal structure of 1,4-BETA-D-XYLAN XYLOHYDROLASE solve using anomalous signal from Seleniomethionine [synthetic construct]
4M29_A	7.86e-38	345	831	30	499	Structureof a GH39 Beta-xylosidase from Caulobacter crescentus [Caulobacter vibrioides CB15]
4EKJ_A	1.06e-37	345	831	30	499	ChainA, Beta-xylosidase [Caulobacter vibrioides]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9ZFM2	7.47e-41	326	831	4	484	Beta-xylosidase OS=Geobacillus stearothermophilus OX=1422 GN=xynB PE=1 SV=1
P23552	2.16e-36	324	796	7	453	Beta-xylosidase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynB PE=3 SV=1
O30360	4.84e-31	336	828	13	479	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=xynB PE=3 SV=1
P36906	3.94e-29	336	798	13	450	Beta-xylosidase OS=Thermoanaerobacterium saccharolyticum OX=28896 GN=xynB PE=1 SV=1
Q05587	4.12e-09	178	278	193	294	Regulatory protein PocR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=pocR PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000251_01871.