CAZyme Information: MGYG000000247_01305

Basic Information

• Species: Collinsella intestinalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella intestinalis
• CAZyme ID: MGYG000000247_01305
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		39867.06	5.6679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000247	1726497	Isolate	China	Asia

• Gene Location: Start: 177429; End: 178493 Strand: +

Full Sequence      

MSDRIRGVNLSGWFILEPWVTPSLFAATGASNDGELQQVLGAVAYNERVREHYETFISEA
DFKRMSAMGLNAVRIPLPWHVFGSQTDRESYISCIDYIDRALEWAEKYEMRVLLDLATVP
GGQGDANGPSVTPDIVGDWHSSVSGRAVALETLERLAERYGERDGLLGIELLDSPVMSVR
KNLLTVTEGIPSHYLRNFYRDAYEAIRRHMPSRKVIVFSDSGHPGAWKRFMAGDRYQNVV
MDLHLYHFRDETAQDITTPRGLAAALGRNKDLIRRATDLGFPVFVGEWSGAAVLAGSSLT
PEGRRAYERVFVSNQLATFDDADGWFFQTWKTERRIAAWDARVALAPLERAMME

Enzyme Prediction     

No EC number prediction in MGYG000000247_01305.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	312	2.3e-61	0.8708609271523179

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	1.61e-26	5	333	18	365	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	9.69e-08	54	290	22	238	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34389.1	7.59e-188	3	354	2	353
AZH68982.1	6.21e-187	3	354	2	353
ATP54675.1	2.52e-186	3	354	2	353
AEB06471.1	1.29e-172	1	353	1	353
QWT17456.1	7.78e-168	4	354	28	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	2.54e-52	4	331	2	358	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	7.01e-52	4	331	2	358	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1EQP_A	3.56e-34	2	333	6	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
3O6A_A	1.03e-33	2	333	11	367	F144Y/F258YDouble Mutant of Exo-beta-1,3-glucanase from Candida albicans at 2 A [Candida albicans]
1CZ1_A	1.31e-33	2	333	6	362	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B5X8	2.89e-43	1	346	25	386	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
A2RAR6	5.18e-42	2	346	39	398	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=exgA PE=3 SV=1
Q12700	1.20e-41	2	340	39	400	Glucan 1,3-beta-glucosidase OS=Schwanniomyces occidentalis OX=27300 PE=3 SV=1
Q7Z9L3	2.27e-40	2	333	28	376	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
B8N151	2.27e-40	2	333	28	376	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000010	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000247_01305.