CAZyme Information: MGYG000000247_00539

Basic Information

• Species: Collinsella intestinalis
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella intestinalis
• CAZyme ID: MGYG000000247_00539
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349	MGYG000000247_1|CGC6	39671.98	6.1703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000247	1726497	Isolate	China	Asia

• Gene Location: Start: 630416; End: 631465 Strand: -

Full Sequence      

MTEQPQTGNTISNGSSTAPNRIDRLAIVVVTFKRQELLAKLFDSFCGLTRAPWRIVIVDN
ENSEQTRQMVEDLGRRTDELWGVEGDAADTEGGTARVVYAPQSGNLGGAGGFSAGVKRAY
ELGAQWFWVMDDDVMVVPEAIERLEPWTHTHRVVQGSRYDYDGGPFYWQYHFIVPLGIPN
PIAPAAFDESGFRAMNTMCFEGGLFARSVVDEIGFPDPRFFIYWDDTVYGYLASKVTESI
VVSDIILQRSRDIPNWDIAGVRQLNGTSDMNRYHIMRNRGYMMQYFRLHGDYNRFLFGLG
TAATFAKEVIRLIAVDHKYKTGMSVLFRGMRDARKIYHDKTWEPMPPLK

Enzyme Prediction     

No EC number prediction in MGYG000000247_00539.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	27	212	1.5e-17	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04185	GT_2_like_b	9.97e-62	28	282	2	202	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	7.91e-22	23	236	3	205	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	1.37e-14	27	171	2	128	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13641	Glyco_tranf_2_3	1.52e-13	23	235	2	196	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd04186	GT_2_like_c	5.27e-12	27	227	1	141	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEB06831.1	5.31e-178	4	348	12	356
BAQ31135.1	2.72e-171	18	349	7	337
AEF31343.1	2.37e-167	20	349	8	336
SDR68445.1	2.37e-167	20	349	8	336
VEH17855.1	2.37e-167	20	349	8	336

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0R5Z2	8.10e-15	28	226	10	194	Galactofuranosyltransferase GlfT1 OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glfT1 PE=1 SV=1
P9WMX2	8.34e-08	28	226	8	191	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=glfT1 PE=3 SV=1
P9WMX3	8.34e-08	28	226	8	191	Galactofuranosyltransferase GlfT1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glfT1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000067	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000247_00539.