CAZyme Information: MGYG000000246_01591

Basic Information

• Species: Streptococcus pasteurianus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Streptococcus; Streptococcus pasteurianus
• CAZyme ID: MGYG000000246_01591
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
485	MGYG000000246_4|CGC3	56056.05	6.5664

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000246	2159802	Isolate	China	Asia

• Gene Location: Start: 85537; End: 86994 Strand: +

Full Sequence      

MGFRSDFLWGGATAANQIEGAFQVGGRGLTTMDTLTVGDATTPRRITYKTLDGKVCKDER
LAKVPEGAIGFLDTDEFYPSHIGIDFYHRYKEDIKLFAEMGFKAYRMSIAWTRIFPNGND
KEPNKAGLAFYDRVFDECLKYGIEPVVTLCHFDMPLHLADHYNGWESREVIKFFEHYCET
VFRRYKNKVKYWLTFNEINVLRSWLQIGIHNNDEQTRFQALHHIFIASAKAVQLCHKIIP
HSKIGNMVMYAPSYAMTAKPEDVIENLLYKRQVEFYLDIQVKGYYPAYKWKEFERKGVTI
KMEEGDLKILERGIVDFIGFSYYMSTMSTTDTSVPKTPGNNLLSYKNPNLAVSEWGWTID
PLGLRVALSEMYDRYHVPLFIVENGLGAVDKIEDDGSINDDYRIDYLAAHIKAMKDAVDL
DGVDLLGYTPWGCIDLIAWSTGEMKKRYGFIYVDVDDRGQGTFKRIKKKSFYWYQEVIRT
NGENI

Enzyme Prediction     

EC	3.2.1.86	3.2.1.23	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	3	482	5.6e-149	0.986013986013986

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	485	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	485	4	473	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	6	485	9	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	483	2	455	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	485	4	477	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXQ77752.1	7.29e-317	1	485	1	485
QGR81584.1	1.03e-237	1	485	1	485
QCT93018.1	2.93e-237	1	485	1	485
AYY10988.1	5.91e-237	1	485	1	485
QDR52282.1	6.59e-237	1	485	1	485

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	7.09e-185	3	485	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.89e-182	6	485	11	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	1.49e-174	6	485	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	4.24e-174	6	485	10	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	8.49e-169	6	485	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46829	1.03e-181	6	485	11	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2
P40740	3.18e-178	3	485	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P42973	1.47e-176	6	485	7	479	Aryl-phospho-beta-D-glucosidase BglA OS=Bacillus subtilis (strain 168) OX=224308 GN=bglA PE=1 SV=1
P24240	8.17e-170	3	485	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
Q46130	2.25e-169	1	485	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000246_01591.