CAZyme Information: MGYG000000242_02108

Basic Information

• Species: Enterocloster sp000431375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp000431375
• CAZyme ID: MGYG000000242_02108
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000000242_10|CGC1	44109.81	4.6737

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000242	3795523	Isolate	China	Asia

• Gene Location: Start: 68584; End: 69699 Strand: +

Full Sequence      

MKNREVINSYIDKWIEDYNNRQRPVWNYEDGCVMLGAQYLYEATGDEKYINCIRTFMDRY
IQEDGTIRYYVPEDYNLDKVNNGRVLYFLYDQTGEEKYKIALSHIREQLETHPRTDCGSF
WHKQIYPYQIWLDGLYMGQPLYLEYEKRFNGGERYNDITGQFLNARKYLFDEEKKLYYHA
YDEKRQMIWADKTTGCSHNFWLRSIGWYLMALIDCCGLIPEESFEHLSTYKRLFKEALAG
IMQYQDEKTKLFYQLVDMPELEGNYLETSGSAMIAYAILKGCRLGILQEEKWRRRGEEIF
DGLEREKLQKDEDGWHLTGICLVAGLGPKDERDGSVEYYLSEPVVSDEEKGVGVFMMAYG
EYLKLEKQDEA

Enzyme Prediction     

No EC number prediction in MGYG000000242_02108.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	18	364	4.1e-106	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4225	YesR	6.07e-100	1	366	10	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam07470	Glyco_hydro_88	4.65e-78	3	365	6	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ93648.1	7.56e-153	3	365	2	364
QHQ62178.1	3.20e-150	9	369	10	369
BCJ96410.1	1.15e-132	3	366	2	365
QTQ12711.1	2.07e-128	6	363	2	357
QTQ13070.1	2.07e-128	6	363	2	357

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	2.52e-106	26	362	23	358	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	3.34e-69	6	361	24	363	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	1.41e-68	6	361	14	353	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
4XUV_A	1.29e-08	26	346	47	353	Crystalstructure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126],4XUV_B Crystal structure of a glycoside hydrolase family 105 (GH105) enzyme from Thielavia terrestris [Thermothielavioides terrestris NRRL 8126]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.83e-68	6	361	24	363	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.80e-44	137	365	1	231	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.80e-44	137	365	1	231	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1
O31521	1.54e-20	5	327	9	324	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000242_02108.