CAZyme Information: MGYG000000242_00131

Basic Information

• Species: Enterocloster sp000431375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Enterocloster; Enterocloster sp000431375
• CAZyme ID: MGYG000000242_00131
• CAZy Family: GH24
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
255	MGYG000000242_1|CGC1	28817.54	9.1844

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000242	3795523	Isolate	China	Asia

• Gene Location: Start: 137356; End: 138123 Strand: -

Full Sequence      

MKISDNGLNLIKKFEGCRLTAYQDAVGVWTIGYGTTNADKAITGTTICQGLKITQETADE
WLRQSVDKKYGPKVDKYSAYNWTQPEFDALVSFAYNIGSIDGLTAKGTRTRSEIAAKILE
YNKAGGKVLSGLIRRRQEERKLFLTPVTVKTGWQQENGGRRFYLKDGSGKYVSNDWHKDG
ELWYWFNGAGMMVHDTWYQYKGSWYYLGSDGAMLKGLQTINGKWYYLDQDGRMATDPVTL
TPDQDGALQYPGLVK

Enzyme Prediction     

No EC number prediction in MGYG000000242_00131.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH24	3	139	8.9e-37	0.9927007299270073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00737	lyz_endolysin_autolysin	6.39e-50	7	144	1	136	endolysin and autolysin. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
cd16901	lyz_P1	1.90e-31	3	142	2	138	P1 lysozyme Lyz-like proteins. Enterobacteria phage P1 lysozyme Lyz is secreted to the Escherichia coli periplasm where it is membrane bound and inactive. Activation involves the release from the membrane, an intramolecular thiol-disulfide isomerization and extensive structural rearrangement of the N-terminal region. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
COG3772	RrrD	4.80e-30	1	147	5	151	Phage-related lysozyme (muramidase), GH24 family [Cell wall/membrane/envelope biogenesis].
cd16900	endolysin_R21-like	1.54e-25	10	144	11	142	endolysin R21-like proteins. Unlike T4 E phage lysozyme, the endolysin R21 from Enterobacteria phage P21 has an N-terminal SAR (signal-arrest-release) domain that anchors the endolysin to the membrane in an inactive form, which act to prevent premature lysis of the infected bacterium. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division. Endolysins and autolysins are found in viruses and bacteria, respectively. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
NF033930	pneumo_PspA	3.94e-22	146	252	438	530	pneumococcal surface protein A. The pneumococcal surface protein proteins, found in Streptococcus pneumoniae, are repetitive, with patterns of localized high sequence identity across pairs of proteins given different specific names that recombination may be presumed. This protein, PspA, has an N-terminal region that lacks a cross-wall-targeting YSIRK type extended signal peptide, in contrast to the closely related choline-binding protein CbpA which has a similar C-terminus but a YSIRK-containing region at the N-terminus.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBL37136.1	1.10e-58	3	150	4	152
BCK01590.1	3.44e-46	4	144	6	142
AYH32979.1	6.07e-36	1	145	1	146
AYY08229.1	3.50e-35	1	145	2	147
QIQ67983.1	9.56e-35	1	145	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ET6_A	1.76e-24	4	144	53	194	ChainA, Lysozyme [Acinetobacter baumannii]
7M5I_A	7.00e-19	1	150	7	160	ChainA, Endolysin [Escherichia coli O157 typing phage 15],7M5I_B Chain B, Endolysin [Escherichia coli O157 typing phage 15]
6H9D_A	2.16e-14	2	146	5	149	ChainA, Lysozyme [Asticcacaulis excentricus],6H9D_B Chain B, Lysozyme [Asticcacaulis excentricus],6H9D_C Chain C, Lysozyme [Asticcacaulis excentricus]
2ANV_A	3.74e-12	1	145	2	146	ChainA, Lysozyme [Lederbergvirus P22],2ANV_B Chain B, Lysozyme [Lederbergvirus P22],2ANX_A Chain A, Lysozyme [Lederbergvirus P22],2ANX_B Chain B, Lysozyme [Lederbergvirus P22]
3HDF_A	2.92e-06	15	144	10	136	ChainA, Lysozyme [Enterobacteria phage P21],3HDF_B Chain B, Lysozyme [Enterobacteria phage P21]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P62692	2.29e-31	1	174	1	175	Endolysin OS=Lactococcus phage c2 OX=31537 GN=L3 PE=3 SV=1
P62693	2.29e-31	1	174	1	175	Endolysin OS=Lactococcus phage phivML3 OX=10746 GN=L3 PE=3 SV=1
Q37896	1.11e-21	1	145	1	144	Endolysin OS=Bacillus phage B103 OX=10778 GN=15 PE=3 SV=1
P11187	3.79e-19	1	167	1	168	Endolysin OS=Bacillus phage phi29 OX=10756 GN=15 PE=1 SV=1
P07540	7.29e-19	1	167	1	168	Endolysin OS=Bacillus phage PZA OX=10757 GN=15 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000242_00131.