CAZyme Information: MGYG000000236_03223

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_03223
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
883	MGYG000000236_18|CGC2	99032.3	6.4097

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 108745; End: 111396 Strand: -

Full Sequence      

MKNIFLTLSLAIGLLLPCNLYAQSQYPFQDTTLSTEERVNDLIGRMTLEEKIDLLAGYND
FYLHPCERLGIPAFKLADGPLGVASWGLFGRATAFPSALSLAASWNKNLAEKTGAMYAQE
WRARGIHFLLAPGVNNYRASKGARNFEYFGEDPYLTSEMVVPFIKAVQDGGVIATIKHFA
ANDQEFDRYTVSTEVSERALQEIYLPPFKAAVQKAGVKAVMTGYNLVNGIHCTENKHLID
ILKKDWGFKGMLMSDWACTYSADNAANYGLDLEMGSNDWFTRKELLPLIKEGKVTEEVIN
DKVRRIYGACISMGFFDRPQQDTHIPTFNPQANQMALNAACEGIILLKNEQNTLPIRQPK
VIAVIGPTANPAIVSDRIYNVNSIVYGGGGSSKVHPWYVVSALEGICQEFPEATVYYTEG
ISNQFKPRLFRNSKFRTKDGKPGLEASYYALSSDSSAMLSDKMIQQQAVAAGRTVNSNQP
GNTASGNGKDENGLIIRRIDRTVNYEWWGYPFNESKLGSDYRICWEGYVDAEKTDSLRFF
VDAQGAYRLWIDGTLALDASRSQSFDVRNIAVSVRKGDTKHVQLEFCNQRSTPAEIRMGY
AYQSDIDFSEAKRLAEKADLVVFCAGLDGSIELEGRDRPFDLPYGQDLLIEELIKVNPKL
IVAIHAGGGVNMTRWINQVPAVVHALYPGQEGGHALAHILSGKVNPSAKLPFTIEKKWED
SPAYGHYDETRKEKKVYYTEGIFTGYRGYDEKGIEPLFPFGFGLSYTTFDYTDLNIRITD
KKQKKVTVSFTITNTGQQDGYEIAQLYVHDIQSKEPRPQKELKGFDKVYLKAGESKQVEI
ELDEDAFRYFNARQNRWVFEKGEFEILVGASSRDIKLTGKIKI

Enzyme Prediction     

No EC number prediction in MGYG000000236_03223.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	67	274	4e-68	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	5.73e-92	1	876	1	758	beta-glucosidase BglX.
COG1472	BglX	3.90e-86	68	414	57	391	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	8.53e-62	17	843	31	743	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	3.71e-47	68	306	63	313	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.08e-44	600	746	73	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM69897.1	0.0	1	883	1	883
QTO27423.1	0.0	1	883	1	883
QCQ36011.1	0.0	1	883	1	883
AUI45424.1	0.0	1	883	1	883
QCQ31780.1	0.0	1	883	1	883

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.04e-125	39	883	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	1.73e-122	39	883	6	836	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.99e-119	39	883	6	836	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
2X40_A	1.71e-105	37	883	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.47e-104	37	883	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2U8Y5	1.49e-139	39	875	6	823	Probable beta-glucosidase I OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglI PE=3 SV=1
B8NDE2	1.60e-138	39	875	6	823	Probable beta-glucosidase I OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglI PE=3 SV=2
A1CA51	6.03e-138	39	875	6	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
A1DFA8	1.36e-135	39	878	6	825	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1
B0Y3M6	1.91e-135	39	875	6	822	Probable beta-glucosidase I OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000279	0.999083	0.000191	0.000161	0.000142	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_03223.