CAZyme Information: MGYG000000236_02553

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_02553
• CAZy Family: GH97
• CAZyme Description: Glucan 1,4-alpha-glucosidase SusB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
671	MGYG000000236_13|CGC1	76392.89	5.5777

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 21937; End: 23952 Strand: -

Full Sequence      

MKQNLHLLFVAFILMSFYSCTPKTELSSPDGHIKVAFATEPDGKMVYRVAVNDTLLLDNS
SLGFEAKDGIDLNQGFRVVKTTFTDKDETWTQPWGENKTNRNHYNEMAVFLKNDANIELT
LRFRAFDDGIAFRYEYEVPGVDSLLVTDELTAFRFHEDGISWSIPASFETYELLYSEQKI
SEVKNANTPFTFKTPGGIYGSIHEAALYDFPEMTLKQDGGHALKSELASWPDGIKARKGN
NFMTSWRTIQIAPAAVGLINSSLILNLNEPCKLETTDWIKPIKYVGVWWGMHLGVETWKM
DDRHGATTANAKKHIDFAHDNNIEGVLFEGWNEGWESWGGMQNFDFTKPYADFDIDEIVR
YAREKNVQIIGHHETGGNIPNYERQMEKAIKWYTEKGIHILKTGYAGAFPDGHSHHGQYG
VNHYQKVVETAARYHMTLDAHEPIKDTGIRRTWPNMMTREGARGMEWNAWSEGNPPSHHE
MLPFTRLLGGPMDYTPGIFDILFTQTKDSPKRQKWNDQDKGNSRVNTTLAKQLANWVILY
SPLQMASDMIEHYEGHPAFQFFRDFDPDCDESKALAGEPGEFVVIVRKAKQNYFLGASTN
EEPRTLPVSLDFLEKGKTYKAIVYADGEQADWKTNPTEYQITEQEVTARDTINIRMAAGG
GQAISFMPLQK

Enzyme Prediction     

No EC number prediction in MGYG000000236_02553.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	14	666	1.2e-231	0.9920760697305864

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	4.59e-144	276	565	2	277	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	1.38e-84	28	270	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	3.25e-43	569	667	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QLK82649.1	0.0	1	671	1	671
QRM70233.1	0.0	1	671	1	671
QCQ45236.1	0.0	1	671	1	671
QTO27695.1	0.0	1	671	1	671
QCQ32080.1	0.0	1	671	1	671

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HQ4_A	2.97e-187	26	669	3	661	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQC_A	2.97e-187	26	669	3	661	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	8.40e-187	26	669	3	661	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
3WFA_A	4.94e-160	25	665	4	702	Catalyticrole of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron],3WFA_B Catalytic role of the calcium ion in GH97 inverting glycoside hydrolase [Bacteroides thetaiotaomicron]
2JKA_A	5.09e-160	25	665	13	711	Nativestructure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKA_B Native structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JKE_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKE_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with deoxynojirimycin [Bacteroides thetaiotaomicron VPI-5482],2JKP_A Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482],2JKP_B Structure of a family 97 alpha-glucosidase from Bacteroides thetaiotaomicron in complex with castanospermine [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
G8JZS4	1.10e-161	1	665	1	722	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1
Q8A6L0	7.32e-56	26	664	25	659	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	6.53e-28	27	663	44	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000015	0.013790	0.986209	0.000005	0.000006	0.000006

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_02553.