CAZyme Information: MGYG000000236_01130

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_01130
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
833	MGYG000000236_5|CGC1	93650.77	6.8375

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 28918; End: 31419 Strand: +

Full Sequence      

MNKKIKIAFVSMLAVPLLVCAQVRTEQTFEKGWKFTREDSKDFSNSTYDDAKWQSVTVPH
DWAIYGPFSINNDKQNVAISQDGQKEAMEHAGRTGGLPFVGVGWYRLDFEAPSFSKGKKA
TLVFDGAMSHAHVYINGQEAGYWPYGYNSFYVDATPYLKPGEKNTLAVRLENENESSRWY
PGAGLYRNVHLVVNEDAHIPTWGTQLTTPVVKDEFAKVNLKTKLDIPAGKTFEGYRIVTE
LKDKNGKVVATNEKQGSQFDGNVFEQDFVVTAPALWTPDTPNLYNAVSKVYEGNTLKDEY
TTPFGIRSIEIIPNKGFFLNGKKTMFKGVCNHHDLGPLGGIANEAGIRRQIRILKDMGCN
AIRTSHNMPAPELIKACDEMGMMIMAESFDEWKAAKVQNGYHKVFDEWAEKDLVNLIHQY
RNNPSVVMWCIGNEVPDQWNGDRGPKLSRFLQDICHREDPTRPVTQGMDAPDAVVNNNMA
AVMDVAGFNYRPHKYQENYKKLPQQIILGSETASTVSSRGVYKFPVVRRAMQKYDDHQSS
SYDVEHCGWSNLPEDDFIQHEDLPYCIGEFVWTGFDYLGEPTPYYTDWPSHSSLFGIIDL
AGLPKDRYYLYRSHWNKDAETLHILPHWNWEGREGEVTPVFVYTNYPSAELFINGKSQGK
RTKDLSVTVHNSGDSASVANFKRQQRYRLMWMDTKYEPGTVKVVAYDKDGKAVAEKEIHT
AGKPDHIELVADRSVIDANGKDLSFVTVKVVDKDGNLCPLADNEISFKVKGAGTYRAGAN
GNPASLESFQTPKMKVFSGMMTAIVQSTEKAGKITLEAAAKGLKKGTLVIESK

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	24	701	3.4e-119	0.6728723404255319

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.24e-61	24	637	10	622	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam18565	Glyco_hydro2_C5	1.12e-46	727	829	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
PRK10150	PRK10150	4.32e-40	33	484	19	462	beta-D-glucuronidase; Provisional
PRK10340	ebgA	7.23e-37	40	464	65	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK09525	lacZ	2.61e-27	47	464	76	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRM70638.1	0.0	1	833	1	833
QCQ51284.1	0.0	1	833	1	833
QTO24391.1	0.0	1	833	1	833
QLK83006.1	0.0	1	833	1	833
QCQ36723.1	0.0	1	833	1	833

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T98_A	1.05e-240	21	831	22	821	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4YPJ_A	2.33e-199	29	823	12	798	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
7CWD_A	1.21e-194	29	830	6	799	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]
5DMY_A	1.51e-152	29	830	41	880	Beta-galactosidase- construct 33-930 [Bifidobacterium bifidum],5DMY_B Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum],5DMY_C Beta-galactosidase - construct 33-930 [Bifidobacterium bifidum]
6QUB_B	3.27e-152	29	830	12	851	Truncatedbeta-galactosidase III from Bifidobacterium bifidum in complex with galactose [Bifidobacterium bifidum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	6.47e-204	24	832	42	848	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.50e-115	24	783	46	770	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	1.10e-58	24	788	51	786	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	7.83e-58	18	832	20	795	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
P77989	3.58e-56	29	818	8	723	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000725	0.535921	0.462690	0.000259	0.000206	0.000184

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_01130.