CAZyme Information: MGYG000000236_00741

Basic Information

• Species: Bacteroides fragilis_A
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides fragilis_A
• CAZyme ID: MGYG000000236_00741
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
678	MGYG000000236_3|CGC6	77905.76	6.5563

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000236	5355078	Isolate	China	Asia

• Gene Location: Start: 161232; End: 163268 Strand: +

Full Sequence      

MKKKNTFTYLLIGLGLCFSSLGSELRADTPENYTNNRYPLVRKPFMELPLGSIKAKGWLQ
EMLVRQKNGATGQMDKLYPLVMGERNGWLGGDGDQWERGPYWIDGLLPLAYLLDDAQLKA
KVQPWIEWALNSQREDGFFGPAKDYPGEAGIQRDNSHDWWPRMVMLKILQQYYSATNDQR
VIRFMTNYFRYQLKTLPEKPLGNWTFWAEFRACDNLQAVYWLYNITGDSFLLDLGKLIHK
QSFSFVDMVNRGDLRRINTIHCVNLAQGIKEPVIYYQQEPDKAYLDAVKRAFSDIRQFHG
QPQGMYGGDEALHGNNPTQGSELCSAVELMHSLEKMVEITGDIDFADHLERIAFNALPTQ
ISDDFMTKQYFQQANQVMVTRHRRNFDQDHGGTDNCFGLLTGYPCCASNMHQGWPKFTQS
LWYATPDGGLAVTAYAPSEVTAKVAEGCMVTFCEDTYYPMDDKISFTLQSMDKKRKEVNF
ALQLRIPKWCKQAGISVNGQLLQHVEGGRMAVVDRIWKKGDRVELHLPMEVTADTWYENS
VAIERGPLVFALKMEEKWEKKKFEEPWYGPYYYAVTPTEPWNYGLVDFNRSKANEHARVT
IHPEKQSSIFPWNKENAPIEIRMKARLIPSWKLYNEMAGPQPYSFCSGGEGPETEITLIP
YGCTTLRITEFPVVGASH

Enzyme Prediction     

No EC number prediction in MGYG000000236_00741.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	318	551	1.3e-35	0.4312977099236641

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	9.43e-62	84	551	49	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	1.16e-27	316	552	286	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP55412.1	2.57e-163	16	675	9	652
QNK64903.1	3.32e-163	10	675	1	646
AMP98056.1	7.00e-163	5	675	2	652
ALL07583.1	8.63e-161	28	675	23	652
QHS59113.1	6.42e-160	1	675	1	652

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	9.33e-19	316	553	375	609	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	2.97e-16	316	553	327	562	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	6.32e-15	316	553	327	562	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	2.99e-14	316	551	331	560	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
6EX6_A	7.07e-10	281	563	267	553	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.04e-08	316	587	332	583	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000675	0.988990	0.009618	0.000238	0.000222	0.000204

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000236_00741.