CAZyme Information: MGYG000000230_00036

Basic Information

• Species: Lactococcus petauri
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Streptococcaceae; Lactococcus; Lactococcus petauri
• CAZyme ID: MGYG000000230_00036
• CAZy Family: GH32
• CAZyme Description: Sucrose-6-phosphate hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
471	MGYG000000230_1|CGC1	54726.95	5.4703

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000230	1982297	Isolate	China	Asia

• Gene Location: Start: 45675; End: 47090 Strand: +

Full Sequence      

MTWTTTERYRAYESYSEDELKTLRERVAQSPWHSTFHIEPETGLLNDPNGFSFFNDKWHL
FYQHFPFGAVHGLKSWVHLTSTDLVHFEKSGLILYPDTKFENAGAFSGSAFPLDDALFIM
YTGNHRKEDWTRIPYQLGAKLDKENQLEKLPEPIIYPNFSETTDHFRDPQIFQHQKKHYM
LIGAQSVAEEGKIKIYRSKNEQLTAWEDLGFLNFTSEKMGYMIECPNLIFINNTPVLIFC
PQGLDQSICSYGNIYPNTYLIADSFSVDKEVRLMGDNRIENLDYGFDCYATQAFNAPDGS
AYAISWLGLPDTTYPTDQFGVQGALSMVKKLSVKDGKLYQTPVDEMKTLRKKKKEFLLKE
ELISTHNVFEMEIDLKSEESHHLNIMANASHESALEIHIDKENDCFTVKRNYEKRTVNVK
IEKVNLFIDKSIFEIFINDGEKVLSGRVFPNKEQYFIQSEKPINIKMWELN

Enzyme Prediction     

EC	3.2.1.26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH32	37	342	3.4e-77	0.9965870307167235

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01322	scrB_fam	3.19e-166	20	451	1	445	sucrose-6-phosphate hydrolase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG1621	SacC	3.51e-141	5	454	1	463	Sucrose-6-phosphate hydrolase SacC, GH32 family [Carbohydrate transport and metabolism].
cd18623	GH32_ScrB-like	9.62e-138	43	335	1	289	glycoside hydrolase family 32 sucrose 6 phosphate hydrolase (sucrase). Glycosyl hydrolase family GH32 subgroup contains sucrose-6-phosphate hydrolase (sucrase, EC:3.2.1.26) among others. The enzyme cleaves sucrose into fructose and glucose via beta-fructofuranosidase activity, producing invert sugar that is a mixture of dextrorotatory D-glucose and levorotatory D-fructose. These retaining enzymes (i.e. they retain the configuration at anomeric carbon atom of the substrate) catalyze hydrolysis in two steps involving a covalent glycosyl enzyme intermediate: an aspartate located close to the N-terminus acts as the catalytic nucleophile and a glutamate acts as the general acid/base; a conserved aspartate residue in the Arg-Asp-Pro (RDP) motif stabilizes the transition state. The breakdown of sucrose is widely used as a carbon or energy source by bacteria, fungi, and plants. Invertase is used commercially in the confectionery industry, since fructose has a sweeter taste than sucrose and a lower tendency to crystallize. A common structural feature of all these enzymes is a 5-bladed beta-propeller domain, similar to GH43, that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
smart00640	Glyco_32	9.62e-119	37	440	1	437	Glycosyl hydrolases family 32.
pfam00251	Glyco_hydro_32N	9.38e-116	37	342	1	308	Glycosyl hydrolases family 32 N-terminal domain. This domain corresponds to the N-terminal domain of glycosyl hydrolase family 32 which forms a five bladed beta propeller structure.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSR02444.1	0.0	1	471	1	471
QSR12752.1	0.0	1	471	1	471
QSR11130.1	0.0	1	471	1	471
QSR04823.1	0.0	1	471	1	471
AWN65216.1	3.05e-237	1	470	1	470

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NU7_A	8.90e-136	1	471	1	486	Structureof sucrose-6-phosphate hydrolase from Lactobacillus gasseri [Lactobacillus gasseri 224-1],6NU8_A Structure of sucrose-6-phosphate hydrolase from Lactobacillus gasseri in complex with fructose [Lactobacillus gasseri 224-1]
7VCO_A	1.07e-48	32	454	25	463	ChainA, Sucrose-6-phosphate hydrolase [Frischella perrara],7VCP_A Chain A, Sucrose-6-phosphate hydrolase [Frischella perrara]
7BWB_A	2.75e-48	10	462	31	472	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 [Bombyx mori]
7BWC_A	3.79e-47	10	462	31	472	Bombyxmori GH32 beta-fructofuranosidase BmSUC1 mutant D63A in complex with sucrose [Bombyx mori]
1UYP_A	2.63e-36	36	467	6	422	Thethree-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_B The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_C The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_D The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_E The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8],1UYP_F The three-dimensional structure of beta-fructosidase (invertase) from Thermotoga maritima [Thermotoga maritima MSB8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q04937	1.63e-233	1	470	1	471	Sucrose-6-phosphate hydrolase OS=Lactococcus lactis subsp. lactis OX=1360 GN=scrB PE=1 SV=1
P13522	1.09e-162	8	462	8	470	Sucrose-6-phosphate hydrolase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=scrB PE=3 SV=3
P43471	6.94e-127	1	451	1	463	Sucrose-6-phosphate hydrolase OS=Pediococcus pentosaceus OX=1255 GN=scrB PE=3 SV=2
Q05936	3.39e-92	3	452	4	466	Sucrose-6-phosphate hydrolase OS=Staphylococcus xylosus OX=1288 GN=scrB PE=3 SV=1
P13394	4.30e-83	3	449	7	453	Sucrose-6-phosphate hydrolase OS=Vibrio alginolyticus OX=663 GN=scrB PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000230_00036.