CAZyme Information: MGYG000000227_04517

Basic Information

• Species: Bacillus sonorensis
• Lineage: Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus; Bacillus sonorensis
• CAZyme ID: MGYG000000227_04517
• CAZy Family: GT2
• CAZyme Description: Tyrocidine synthase 3

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
2305	MGYG000000227_13|CGC1	260104.21	6.1039

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000227	4782975	Isolate	China	Asia

• Gene Location: Start: 36814; End: 43731 Strand: +

Full Sequence      

MGEYVEEYAVSSAQKRMYMLQQLHPRETAYNMPLVLTAEGKLDQERLQQAFQKLIKRHES
LRTRFVIVDGEPVQQIEEDVSFTVCSANGTEEEAGQWVQSFVEPFDLSAAPLLRVGVMRL
SEETHLLAIDMHHIICDGVAISILVNEFNELYHGAELPPLRIQYKDFAVWQNERRKSEAY
KKQEEYWLKQLSGELPVLQLPTDRKRPAAQSFIGGAVESSVSPELAHKLKQLAGESGATL
FMVLLAAYQTLLARYSGQEDIIVGSPIAGRPHADLEKIVGMFVNTLALRGYPQREKTFRA
FLEEMKETALQAYEHQEVPFEALVERLGAPRDVNRNPLFDAMFVLQNTESAELAMDGLTL
RPYQQKHRIAKFDLTLQAEEKNGELQLTWEYRTELFERETIERWTTHWLQLLEQVADDPD
IRLGEIDLLTKTEKHRLLHTFNGTKAAAPNDRTVHQLFEEQAERTPEKTAVVCGAARLTY
RELNNRANHLAYMLRENGVKPDTTVALMADRSPLVIVSILGILKAGGAYVPIDPSHPEER
IQFVIKDSKADILITQKQLTIDVMDSKRILNLQQINWEGLGDPDHLPPSASPDNLAYVIY
TSGTTGKPKGVMVEHRSVAHNLLWHADEYRLTSENTFLQLGAYTFDASILSTFSPLLTGA
TVAMAGEDQARDPNAVSTIIASDNVTHLCCPPSFYTLLLDALTPEAAASLRTVIMGGERL
PEHMVYRSKRNFPFIELVNEYGPTESCVTSSVQRDVCPDENITIGRPIRGTRMYIVNEAC
SLQPIGAPGELCISGKGLARGYVNQPELSAEKFVANPYAPGERMYRTGDLARWLPDGSIE
FLGRIDHQVKIRGYRIEPGEIEQTLLAYEAIKEAAVIAKEEADGDKTLCAYYVACLPVNP
GDVRAHTTAALPFYMVPSFFIELDRMPVTPNGKLDEKALPEPDRLSAAAEYVEPATQAER
DLALIWQEVLGVERVGAADHFFKLGGHSLKAMLLVSRIHRELGAEVPVRDVFQHPTVRQL
ALRIEADGEVSAYKEIEPVPLQQEYPVSPAQKRMYMLHHMHPETTAYHIPTVMVVEGAFN
LQRLEQAIHALIRRHESLRTRFVLKEGVPMQIVEEDVPFSLPHTCGTEADAERWVDSIVQ
PFDLSAAPLFRAGVMSISNERHLLVIDMHHIIADGMTMSIFINEFNALYQGFELKPLRIQ
YKDFAVWQNSRIQKKAYRAKEAYWLAQLAGELPYLKLPGDKPRPSVQDFRGGVVESTADA
ELKRKLERLAEQNGATLYMVLLAAYQTLLSRYSGQDDIIVGSPIAGRPHPDLEKIAGMFV
NTLALRGYPKEEKTFQAFLTDIKKTTLEAFDHQEVPFEALVEKLEVRRDINRNPVFDVMF
SFQNIEQHELKMDGLKLRQCDRKHTTAKFDLTMRVKEQSGRLLFALEYSTALFKQETVER
WAGHWQQLLEQVAADPDIRLGEIDILTEKERHQLLHTFNEEKSGEPTNKTIHQLFEEQVY
HRPSQTAVICEDQSITYRELNDRANRLARLLRKKGVRPDDIVGLAVERSVEMIIGIIGIL
KAGGAYLPLDLNSPEERTGFILEDSHAKFLLRRQNGQNIPFAGETVLLGEIESLPAESNL
PAVSSPQHLAYAIYTSGSTGKPKGVLIEQSNVVNLVDGLYQRIYRHYAESLKIALIAPVY
FDASVKQIFASLLLGHTLVIAPEAARFDHRLLTGFYHRQNIDISDGTPAHLQLLAGAKRP
VHVKHFIIGGEALPADLVERIWEMYGGGPKPVITNIYGPAECTVDAVSYHVKPGNHRTIP
IGKPLPNDQVYIMNRYNKLQPVGVAGELCIGGAGLARGYLNRPELTREKFAAHPFTPGAR
MYKTGDLARWLPDGNIEYIGRTDHQINLRGFRIEPGEIENRLLEHPAVKEAAVIMREDTG
GDKALCAYYVTERPTEAKQLRSHLEVALPPYMVPAFFISLEQMPLTANGKLDRHALPKPD
GAVSAAEHVPPDTAAEAQLARLWQEVLGIGRIGVEDHFFELGGHSLKAMTLIWRIKQEMN
LDVPLQAVFQYPRIRDFAGFIASSKQLSFDQLKGHMVQLSKKGDGNLYCFPGIGGAGYIF
RTLCEHLPGWNGFGMNYIESPNRIGEYVEQIKRIQPHGPYYFLAYSAGSALAYEVIKQLE
SNNDRVEQLILFDCRMENSKEKLDQQKVEKHAEEFVEQFIIEQFVKKNNIQDHAHITYLR
NQGRKSVLSFYQYRQEMVYEAPINAEIHRIEAEHEKWDNQDIANMTIQKPFSYQGYGAHQ
EMLNSPFAEKNAEILLGILNKVKSL

Enzyme Prediction     

No EC number prediction in MGYG000000227_04517.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12467	PRK12467	0.0	1038	2173	2637	3792	peptide synthase; Provisional
cd19531	LCL_NRPS-like	0.0	1044	1456	1	427	LCL-type Condensation (C) domain of non-ribosomal peptide synthetases(NRPSs) and similar domains including the C-domain of SgcC5, a free-standing NRPS with both ester- and amide- bond forming activity. LCL-type Condensation (C) domains catalyze peptide bond formation between two L-amino acids, ((L)C(L)). C-domains of NRPSs catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). In addition to the LCL-type, there are various subtypes of C-domains such as the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. Streptomyces globisporus SgcC5 is a free-standing NRPS condensation enzyme (rather than a modular NRPS), which catalyzes the condensation between the SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and (R)-1phenyl-1,2-ethanediol, forming an ester bond, during the synthesis of the chromoprotein enediyne antitumor antibiotic C-1027. It has some acceptor substrate promiscuity as it has been shown to also catalyze the formation of an amide bond between SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and a mimic of the enediyne core acceptor substrate having an amine at its C-2 position. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity. An HHxx[SAG]DGxSx(6)[ED] motif is characteristic of LCL-type C-domains.
cd19531	LCL_NRPS-like	0.0	7	419	1	427	LCL-type Condensation (C) domain of non-ribosomal peptide synthetases(NRPSs) and similar domains including the C-domain of SgcC5, a free-standing NRPS with both ester- and amide- bond forming activity. LCL-type Condensation (C) domains catalyze peptide bond formation between two L-amino acids, ((L)C(L)). C-domains of NRPSs catalyze peptide bond formation within (usually) large multi-modular enzymatic complexes. NRPS can use a large variety of acyl monomers (approximately 500 different possible monomer substrates as opposed to the 20 standard amino acids in ribosomal protein synthesis) to construct bioactive secondary metabolites of 2 to 18 units long (with various activities such as antibiotic, antifungal, antitumor and immunosuppression). In addition to the LCL-type, there are various subtypes of C-domains such as the DCL-type which links an L-amino acid to the D-amino acid at the end of a growing peptide, starter C-domains which acylate the first amino acid with a beta-hydroxy carboxylic acid, and heterocyclization (Cyc) domains which catalyze both peptide bond formation and cyclization of Cys, Ser, or Thr residues. Typically, an NRPS module consists of an adenylation domain, a peptidyl carrier protein (PCP) domain (also known as thiolation (T) domain) and a C-domain. NRPS modules may also include specialized domains such as the terminal-module thioesterase (Te) domain that releases the product via hydrolysis or macrocyclization and any of various C-domain family members such as the epimerization (E) domain, the ester-bond forming C-domain, dual E/C (epimerization and condensation) domains, and the X-domain. Streptomyces globisporus SgcC5 is a free-standing NRPS condensation enzyme (rather than a modular NRPS), which catalyzes the condensation between the SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and (R)-1phenyl-1,2-ethanediol, forming an ester bond, during the synthesis of the chromoprotein enediyne antitumor antibiotic C-1027. It has some acceptor substrate promiscuity as it has been shown to also catalyze the formation of an amide bond between SgcC2-tethered (S)-3-chloro-5-hydroxy-beta-tyrosine and a mimic of the enediyne core acceptor substrate having an amine at its C-2 position. C-domains typically have a conserved HHxxxD motif at the active site; mutations in this motif can abolish or diminish condensation activity. An HHxx[SAG]DGxSx(6)[ED] motif is characteristic of LCL-type C-domains.
PRK12467	PRK12467	0.0	3	2071	45	2174	peptide synthase; Provisional
cd17655	A_NRPS_Bac	0.0	1493	1980	1	490	bacitracin synthetase and related proteins. This family of the adenylation (A) domain of nonribosomal peptide synthases (NRPS) includes bacitracin synthetases 1, 2, and 3 (BA1, also known as ATP-dependent cysteine adenylase or cysteine activase, BA2, also known as ATP-dependent lysine adenylase or lysine activase, and BA3, also known as ATP-dependent isoleucine adenylase or isoleucine activase) in Bacilli. Bacitracin is a mixture of related cyclic peptides used as a polypeptide antibiotic. This family also includes gramicidin synthetase 1 involved in synthesis of the cyclic peptide antibiotic gramicidin S via activation of phenylalanine. NRPSs are large multifunctional enzymes which synthesize many therapeutically useful peptides in bacteria and fungi via a template-directed, nucleic acid independent nonribosomal mechanism. These natural products include antibiotics, immunosuppressants, plant and animal toxins, and enzyme inhibitors. NRPS has a distinct modular structure in which each module is responsible for the recognition, activation, and in some cases, modification of a single amino acid residue of the final peptide product. The modules can be subdivided into domains that catalyze specific biochemical reactions.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QND46664.1	0.0	8	2174	561	2785
BAY90071.1	4.70e-269	186	2173	317	3404
BAZ00088.1	7.51e-259	186	2173	318	3413
BAZ75991.1	7.51e-259	186	2173	318	3413
BAY30132.1	6.69e-258	186	2173	318	3415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MFY_A	0.0	449	1989	202	1725	Crystalstructure of a 5-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis],6MG0_A Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis],6MG0_B Crystal structure of a 5-domain construct of LgrA in the thiolation state [Brevibacillus parabrevis]
6MFZ_A	0.0	449	2065	202	1801	Crystalstructure of dimodular LgrA in a condensation state [Brevibacillus parabrevis],6MFZ_B Crystal structure of dimodular LgrA in a condensation state [Brevibacillus parabrevis]
5U89_A	1.28e-223	433	1475	6	1071	Crystalstructure of a cross-module fragment from the dimodular NRPS DhbF [Geobacillus sp. Y4.1MC1]
6MFW_A	2.55e-208	449	1470	202	1205	Crystalstructure of a 4-domain construct of LgrA in the substrate donation state [Brevibacillus parabrevis]
6MFX_A	1.30e-207	449	1470	202	1205	Crystalstructure of a 4-domain construct of a mutant of LgrA in the substrate donation state [Brevibacillus parabrevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P45745	0.0	7	2174	8	2229	Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=dhbF PE=1 SV=4
Q70LM4	0.0	8	2071	8	2103	Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis OX=54914 GN=lgrD PE=1 SV=1
Q04747	0.0	2	2077	1052	3122	Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=srfAB PE=1 SV=3
P94459	0.0	6	2064	1055	3107	Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) OX=224308 GN=ppsD PE=1 SV=2
Q70LM5	0.0	8	2071	5187	7280	Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis OX=54914 GN=lgrC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000227_04517.